SecReT6
Protein ID: 255037339
SecReT6 ID911
T6SS typeiii
Gene symbol-
Locus tagDfer_3588
StrainDyadobacter fermentans DSM 18053
Repliconchromosome [GenBank: NC_013037] [Browse all T6SS(s) in this replicon]
Location [Strand]4381733..4382233 [+]
Producthypothetical protein
NoteHcp
UniProt IDC6VU27
KEGG IDdfe:Dfer_3588
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 166 a.a.     [Download]
>gi|255037339|ref|YP_003087960.1| hypothetical protein Dfer_3588 [Dyadobacter fermentans DSM 18053]
MAEQDATIGVEAHLTLDGKAFTVRKIAYGCNRNADERGSPTDSPKVRLIRMTITPTQNDDFALLYDWAFK
NDRKLSGQVEFKYDNDSQILRKMEFEEAYCVGFREAFRAKRSTIRGHQLAHVPDTKGYLPQHRGKHYFLR
DSSLALVYELVILPQKVKIGQVEISS
 
Nucleotide Sequence: 501 bp     [Download]
>gi|255033817|ref|NC_013037.1|:4381733-4382233 Dyadobacter fermentans DSM 18053 chromosome, complete genome
ATGGCTGAGCAGGACGCTACCATTGGCGTGGAGGCGCATTTGACGCTCGACGGGAAGGCATTTACCGTCC
GAAAGATCGCATACGGCTGCAACCGCAACGCCGACGAGCGCGGTAGTCCGACGGATTCTCCGAAGGTCCG
GCTCATCCGGATGACGATCACTCCCACGCAGAACGACGATTTCGCATTGCTCTACGACTGGGCATTCAAA
AATGACCGGAAACTGAGCGGACAGGTAGAGTTCAAATACGACAACGACTCGCAGATCCTGCGCAAAATGG
AGTTTGAAGAGGCCTATTGCGTCGGTTTCCGCGAGGCGTTTCGGGCGAAGCGGTCGACGATCCGCGGACA
CCAACTCGCGCATGTGCCGGATACGAAAGGTTACCTGCCGCAGCATCGCGGCAAACATTATTTCCTGCGC
GACAGCAGCCTCGCATTGGTTTACGAGCTGGTGATTTTGCCGCAGAAAGTCAAAATCGGACAGGTTGAAA
TAAGCAGTTAA