SecReT6
Protein ID: 255037341
SecReT6 ID911
T6SS typeiii
Gene symbol-
Locus tagDfer_3590
StrainDyadobacter fermentans DSM 18053
Repliconchromosome [GenBank: NC_013037] [Browse all T6SS(s) in this replicon]
Location [Strand]4384119..4384535 [+]
Producthypothetical protein
NoteHcp
UniProt IDC6VU29
KEGG IDdfe:Dfer_3590
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 138 a.a.     [Download]
>gi|255037341|ref|YP_003087962.1| hypothetical protein Dfer_3590 [Dyadobacter fermentans DSM 18053]
MPASSFDAYFTWDGGPSGDGIAVISCSYALSQSIDDKGRVSSKVYGGTVFIQVDSSSASDSQSLWEWMVD
PDGKKPSAKITFKNVDEEQTQKELELTDVYCVQYSESFVETGSMPMTTSLTLSAREIKLFGTPHTNRW
 
Nucleotide Sequence: 417 bp     [Download]
>gi|255033817|ref|NC_013037.1|:4384119-4384535 Dyadobacter fermentans DSM 18053 chromosome, complete genome
ATGCCAGCTTCAAGTTTTGACGCTTATTTTACCTGGGATGGCGGCCCGTCCGGCGACGGTATTGCCGTGA
TCTCGTGCAGCTACGCCCTGTCCCAATCCATTGACGATAAAGGACGCGTTTCTTCCAAAGTATATGGAGG
TACCGTTTTCATACAAGTCGATTCTTCGAGCGCCAGCGACAGCCAGAGCCTCTGGGAATGGATGGTAGAC
CCGGACGGCAAAAAGCCTTCGGCCAAAATCACTTTCAAAAACGTGGATGAGGAACAAACGCAGAAGGAGC
TAGAACTGACCGACGTGTACTGCGTGCAATACAGCGAAAGTTTCGTGGAAACCGGCTCGATGCCCATGAC
AACCAGCCTGACGCTTTCGGCTCGGGAGATCAAGCTGTTCGGTACGCCGCATACTAACCGCTGGTAG