SecReT6
Protein ID: 255037342
SecReT6 ID911
T6SS typeiii
Gene symbol-
Locus tagDfer_3591
StrainDyadobacter fermentans DSM 18053
Repliconchromosome [GenBank: NC_013037] [Browse all T6SS(s) in this replicon]
Location [Strand]4384638..4385405 [-]
Producthypothetical protein
NoteTssN
UniProt IDC6VU30
KEGG IDdfe:Dfer_3591
PDB IDNA
Domain hit(s) vs Pfam NnrS [PF05940], Evalue: 0.00023, Aligned region: 18..145
Protein Sequence: 255 a.a.     [Download]
>gi|255037342|ref|YP_003087963.1| hypothetical protein Dfer_3591 [Dyadobacter fermentans DSM 18053]
MNLPFVKTVTQRLQLLYAVVLTALLTLVGALGFWIIDYRDAYPMAMGAFLLLGILHVYLLSQWFGRLFEN
RSARAIGFTLLITLLTALAVIFLYHKVAQELSKGLGMATALVGFLFPVFVARVYQSYLEIPLRDYKKWHY
PVGQPLPDMDLLDLSRVLVIQFEFTKTAGEPAFTNFRAKAPHSMLFGELFFIFLNDYNDRNPGSPVEYLA
PDGTPYGWLFYKKLPWYKRRVYMDPDLTFQANHIVDNETIVAVRG
 
Nucleotide Sequence: 768 bp     [Download]
>gi|255033817|ref|NC_013037.1|:c4385405-4384638 Dyadobacter fermentans DSM 18053 chromosome, complete genome
ATGAACCTTCCGTTTGTTAAAACTGTCACACAACGCCTTCAACTTTTGTATGCAGTCGTGCTGACAGCCT
TGCTGACGTTGGTAGGGGCGCTCGGTTTCTGGATCATCGACTACCGCGACGCCTATCCGATGGCCATGGG
CGCCTTTCTCTTATTGGGTATCCTGCACGTTTACCTGCTTTCGCAATGGTTTGGCCGGCTTTTTGAAAAC
CGTTCCGCGCGGGCAATCGGTTTTACCTTGCTGATCACGCTGCTGACGGCCCTTGCAGTCATTTTTTTGT
ATCACAAAGTCGCGCAGGAGCTTTCTAAAGGTTTGGGAATGGCTACGGCGCTGGTGGGTTTTTTGTTCCC
GGTTTTTGTAGCGCGGGTTTATCAGAGTTACCTCGAAATTCCGCTCAGGGATTATAAAAAGTGGCATTAC
CCGGTAGGGCAGCCGTTGCCGGACATGGATCTGCTCGATCTTTCCCGCGTGCTGGTAATCCAGTTTGAAT
TTACCAAAACGGCGGGCGAGCCCGCATTCACCAACTTCCGGGCCAAGGCACCGCATTCAATGCTATTCGG
CGAGCTGTTTTTTATTTTCCTGAACGACTACAATGATCGCAATCCCGGCAGCCCGGTCGAGTATCTCGCG
CCCGATGGCACGCCGTACGGCTGGCTGTTCTATAAAAAGTTACCCTGGTACAAGCGCCGCGTTTATATGG
ACCCGGACCTTACTTTCCAGGCCAATCACATTGTCGATAATGAGACAATCGTGGCCGTGCGAGGGTAG