SecReT6
Protein ID: 255037343
SecReT6 ID911
T6SS typeiii
Gene symbol-
Locus tagDfer_3592
StrainDyadobacter fermentans DSM 18053
Repliconchromosome [GenBank: NC_013037] [Browse all T6SS(s) in this replicon]
Location [Strand]4385483..4385911 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDC6VU31
KEGG IDdfe:Dfer_3592
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-12, Aligned region: 26..126
Protein Sequence: 142 a.a.     [Download]
>gi|255037343|ref|YP_003087964.1| GPW/gp25 family protein [Dyadobacter fermentans DSM 18053]
MEDQNYSLPLSLDRIVAGQPHPKCPDREAIHQHLYLLMVTHFDENRFDSRYGCALWDHDFSVLSQIKWKD
LIRESLEEAVNTYERRLTNIKIRVEMEEFEVLTKTNNYVRKRVGIEIKATIRRTNEPFIFFERIFISPLS
IE
 
Nucleotide Sequence: 429 bp     [Download]
>gi|255033817|ref|NC_013037.1|:4385483-4385911 Dyadobacter fermentans DSM 18053 chromosome, complete genome
ATGGAAGATCAAAACTATTCGCTGCCGCTTTCGCTGGACCGGATCGTGGCTGGCCAGCCCCATCCGAAAT
GCCCCGACAGGGAAGCGATCCACCAGCATTTGTACCTGCTCATGGTCACGCATTTCGATGAAAACCGGTT
CGACAGTCGCTACGGCTGCGCACTTTGGGACCATGATTTTTCGGTTTTATCCCAAATCAAATGGAAAGAC
CTCATCCGCGAATCGCTGGAAGAAGCTGTAAATACCTATGAGCGCAGGCTGACGAACATCAAAATCCGTG
TGGAAATGGAAGAATTTGAGGTTTTGACCAAAACCAACAACTACGTCCGCAAGCGTGTCGGCATCGAAAT
CAAGGCGACCATCCGGCGCACGAACGAACCGTTCATTTTCTTCGAACGCATTTTCATATCACCCTTATCC
ATCGAATGA