SecReT6
Protein ID: 255037344
SecReT6 ID911
T6SS typeiii
Gene symbol-
Locus tagDfer_3593
StrainDyadobacter fermentans DSM 18053
Repliconchromosome [GenBank: NC_013037] [Browse all T6SS(s) in this replicon]
Location [Strand]4385913..4387718 [+]
Producthypothetical protein
NoteTssF
UniProt IDC6VU32
KEGG IDdfe:Dfer_3593
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 601 a.a.     [Download]
>gi|255037344|ref|YP_003087965.1| hypothetical protein Dfer_3593 [Dyadobacter fermentans DSM 18053]
MTETMRYTKENISRRLIKRCTELWGIDDALADHFDPLVRLLVEACSVEFEKVGQEIEHTELRLMTRLAEI
LSPESHNGPQPATAIVQARPQEPTGWIEPENQLTGKRTNIRKGETTEVHFVPTGRYPLVNAAIVQFATPL
ALFSVEKGIKTLVSKTLPQPGGEQSIWLGLDIDPGITTWNGFRFFFDWTGDPAEYQYRAFLPAASWRANG
KPLTIANGLDENSVDDAILVYNSSFARIESDDSWEKGKLKTEPYPDAFARMFDSRTLQTLKKPLVWIEIT
WPTVFPSQGFEQMDVWLNAFPVQNKQLNKITYRLQSGLNGIALPSGDAFMGVKSVINQKNEVYSASEKNL
YNEEEDAPRPNARRIYTLRRQGIGRFDKRDARAVLYQLMELLRDEVTAFNAIGEDFLASILREIAQNMAR
IEQKLGVKKASETTAQPFLVIRGEKNPDVLFISYWSTLAEQANGIPAGTRLQSYSATGVSGGDIILLTRS
SGGKAKPDETDYVNELRKNIVTRNRLVTLEDVRAYCTAELGDRLRDVHVKPHFIPGQMPGQGFVRCLQIG
LTPAARPSEDWARECELLQMKVTRLSTGMYPIQVVTLPANA
 
Nucleotide Sequence: 1806 bp     [Download]
>gi|255033817|ref|NC_013037.1|:4385913-4387718 Dyadobacter fermentans DSM 18053 chromosome, complete genome
ATGACAGAGACGATGCGCTACACGAAGGAAAACATTTCGCGCAGGCTGATCAAACGCTGCACCGAGCTTT
GGGGCATCGACGACGCCCTGGCCGATCATTTCGACCCGCTCGTACGGCTGCTGGTGGAGGCCTGCTCGGT
GGAATTTGAAAAGGTGGGACAGGAAATTGAACACACCGAACTCCGGCTGATGACCCGGCTCGCCGAAATC
CTCTCTCCCGAAAGCCATAACGGTCCGCAACCGGCCACAGCCATCGTGCAGGCGCGCCCGCAGGAGCCTA
CGGGTTGGATTGAGCCCGAGAACCAACTCACGGGCAAGCGCACGAATATCCGCAAGGGCGAAACCACCGA
AGTACATTTCGTGCCCACGGGCCGGTATCCGCTTGTAAACGCGGCCATTGTGCAGTTTGCAACGCCGCTG
GCGCTTTTTTCGGTTGAAAAAGGCATTAAAACACTCGTTTCCAAAACATTACCGCAGCCCGGCGGTGAGC
AGAGCATCTGGCTGGGGCTGGATATCGACCCCGGTATTACAACCTGGAACGGTTTCCGCTTCTTTTTCGA
CTGGACCGGCGACCCGGCGGAATACCAATACCGGGCTTTCCTCCCGGCCGCAAGCTGGCGGGCAAACGGC
AAACCGCTCACCATTGCAAACGGCCTGGACGAGAACTCCGTGGACGACGCCATACTCGTGTACAACAGCA
GCTTCGCGCGCATTGAAAGCGACGACTCCTGGGAAAAAGGCAAACTTAAAACCGAACCCTACCCCGATGC
ATTCGCCCGAATGTTCGATTCGCGGACGCTGCAAACATTGAAAAAACCCCTGGTTTGGATCGAAATCACC
TGGCCGACGGTATTTCCGTCCCAGGGATTTGAACAAATGGATGTGTGGCTGAATGCATTTCCCGTCCAGA
ACAAACAGCTCAACAAAATCACTTACCGCCTCCAAAGCGGGCTGAACGGGATCGCATTACCGAGCGGCGA
TGCATTTATGGGGGTAAAAAGTGTTATTAACCAAAAAAATGAGGTTTACTCAGCCTCCGAAAAGAACCTT
TATAACGAAGAAGAAGACGCTCCCCGACCCAACGCAAGGCGCATTTACACCCTCCGCAGACAGGGCATCG
GCCGGTTCGACAAGCGCGACGCCCGGGCAGTCTTGTATCAGCTCATGGAGCTGCTTCGCGACGAGGTTAC
GGCTTTCAATGCAATCGGAGAGGATTTCCTGGCGTCCATTCTCAGGGAAATTGCGCAGAACATGGCGCGG
ATCGAGCAGAAGCTGGGCGTTAAAAAAGCCAGCGAAACCACCGCACAACCATTTCTGGTTATCCGGGGTG
AAAAAAATCCGGATGTTCTTTTCATATCGTATTGGAGCACGCTGGCCGAACAGGCCAATGGCATTCCGGC
AGGTACGCGGCTGCAATCCTATTCGGCGACAGGCGTGAGCGGTGGGGACATTATCCTGCTTACCCGGTCA
TCGGGCGGCAAAGCCAAGCCGGACGAAACCGATTATGTGAATGAACTTCGCAAGAACATCGTCACGCGCA
ACAGGCTCGTTACGCTGGAAGATGTACGCGCCTATTGCACCGCCGAGCTGGGCGATCGGCTCCGGGACGT
GCACGTAAAACCGCATTTCATACCTGGCCAAATGCCCGGACAAGGCTTTGTACGCTGCCTGCAAATAGGC
CTCACGCCCGCCGCACGCCCGAGCGAAGACTGGGCCCGCGAATGCGAATTGCTGCAAATGAAAGTTACCC
GGCTATCCACCGGCATGTACCCGATTCAGGTCGTCACACTACCCGCCAACGCCTGA