SecReT6
Protein ID: 255037345
SecReT6 ID911
T6SS typeiii
Gene symbol-
Locus tagDfer_3594
StrainDyadobacter fermentans DSM 18053
Repliconchromosome [GenBank: NC_013037] [Browse all T6SS(s) in this replicon]
Location [Strand]4387789..4388679 [+]
Producthypothetical protein
NoteTssG
UniProt IDC6VU33
KEGG IDdfe:Dfer_3594
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 296 a.a.     [Download]
>gi|255037345|ref|YP_003087966.1| hypothetical protein Dfer_3594 [Dyadobacter fermentans DSM 18053]
MNPRPDLKAEFIASSWLETGVPAGQILFRPLGDFKRRSHLDVESVRELELGNFKGHVIESNRSGIYDHLP
EQLFHLPSSANLNTVKKKVDEIRLQRENEQQSRLFFLPLEQEFFLNRVTLARLEQCAWELGPDSGLLEEL
KAFWQAPATLDADVFVQLLPFLPLVSEYRGNLDKAAEIMSIALRLPVAVQAVTGLKCYCETHASMGDAAL
GSDTALGGELDAGMPAIQVEIEMPGAAELDRHLHDEHFKALVNWLLGWFVPVECDILTALTLPPGQSAFM
LADDDSPAVPLGYFTI
 
Nucleotide Sequence: 891 bp     [Download]
>gi|255033817|ref|NC_013037.1|:4387789-4388679 Dyadobacter fermentans DSM 18053 chromosome, complete genome
ATGAACCCCCGCCCCGACCTCAAAGCCGAATTCATCGCCAGCTCATGGCTCGAAACCGGCGTGCCTGCCG
GACAGATCCTCTTTCGGCCGCTAGGGGATTTCAAAAGACGCAGCCACCTGGATGTGGAGAGCGTTCGCGA
ACTGGAACTGGGGAATTTCAAAGGGCACGTTATCGAATCCAACCGCAGCGGCATTTACGACCATCTGCCC
GAGCAGCTATTTCACCTTCCGTCGTCGGCAAACCTGAATACGGTTAAAAAGAAGGTGGACGAAATACGCC
TTCAACGCGAAAATGAACAGCAGTCGCGGCTCTTCTTCCTGCCTTTGGAACAAGAATTCTTTTTGAACCG
GGTCACACTCGCCCGGCTGGAACAATGCGCGTGGGAACTGGGGCCGGATTCGGGGTTGCTGGAAGAGCTA
AAAGCGTTCTGGCAGGCGCCGGCGACGCTGGATGCGGACGTGTTTGTACAGTTGCTTCCGTTTCTGCCCC
TTGTGTCGGAATACCGCGGTAATCTGGATAAGGCAGCGGAGATCATGTCCATTGCATTGCGGCTACCGGT
TGCGGTCCAGGCGGTTACGGGCCTGAAATGCTATTGCGAAACCCATGCGAGTATGGGCGATGCGGCGCTC
GGATCGGACACGGCGTTAGGCGGCGAGCTGGACGCCGGAATGCCCGCCATCCAGGTGGAAATCGAAATGC
CCGGCGCCGCGGAGCTGGACAGGCACCTTCATGATGAGCACTTCAAAGCGCTCGTAAACTGGCTGCTGGG
CTGGTTCGTCCCGGTTGAATGCGACATCCTGACCGCGCTGACACTCCCGCCCGGCCAATCCGCATTCATG
CTCGCTGACGACGATAGCCCGGCGGTGCCGCTGGGCTACTTTACGATTTGA