SecReT6
Protein ID: 256421339
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2300
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2833322..2835772 [+]
ProductATPase AAA
NoteClpV
UniProt IDC7PG59
KEGG IDcpi:Cpin_2300
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.00E-47, Aligned region: 203..259
AAA_2 [PF07724], Evalue: 8.00E-47, Aligned region: 552..714
ClpB_D2-small [PF10431], Evalue: 7.70E-20, Aligned region: 721..799
AAA [PF00004], Evalue: 1.10E-18, Aligned region: 205..317
AAA [PF00004], Evalue: 1.10E-18, Aligned region: 558..675
AAA_16 [PF13191], Evalue: 8.20E-16, Aligned region: 183..236
AAA_16 [PF13191], Evalue: 8.20E-16, Aligned region: 249..285
AAA_16 [PF13191], Evalue: 8.20E-16, Aligned region: 393..428
AAA_16 [PF13191], Evalue: 8.20E-16, Aligned region: 525..592
AAA_5 [PF07728], Evalue: 5.20E-15, Aligned region: 205..237
AAA_5 [PF07728], Evalue: 5.20E-15, Aligned region: 556..674
AAA_22 [PF13401], Evalue: 5.60E-12, Aligned region: 200..323
AAA_22 [PF13401], Evalue: 5.60E-12, Aligned region: 401..470
AAA_22 [PF13401], Evalue: 5.60E-12, Aligned region: 555..650
Sigma54_activat [PF00158], Evalue: 5.80E-11, Aligned region: 196..233
Sigma54_activat [PF00158], Evalue: 5.80E-11, Aligned region: 556..685
AAA_17 [PF13207], Evalue: 1.10E-08, Aligned region: 51..95
AAA_17 [PF13207], Evalue: 1.10E-08, Aligned region: 205..270
AAA_17 [PF13207], Evalue: 1.10E-08, Aligned region: 560..591
AAA_14 [PF13173], Evalue: 2.80E-08, Aligned region: 204..315
AAA_14 [PF13173], Evalue: 2.80E-08, Aligned region: 559..652
NACHT [PF05729], Evalue: 4.70E-07, Aligned region: 205..233
NACHT [PF05729], Evalue: 4.70E-07, Aligned region: 267..348
NACHT [PF05729], Evalue: 4.70E-07, Aligned region: 413..482
NACHT [PF05729], Evalue: 4.70E-07, Aligned region: 558..580
AAA_18 [PF13238], Evalue: 7.50E-07, Aligned region: 205..281
AAA_18 [PF13238], Evalue: 7.50E-07, Aligned region: 558..576
IstB_IS21 [PF01695], Evalue: 7.70E-07, Aligned region: 16..45
IstB_IS21 [PF01695], Evalue: 7.70E-07, Aligned region: 202..322
IstB_IS21 [PF01695], Evalue: 7.70E-07, Aligned region: 425..471
IstB_IS21 [PF01695], Evalue: 7.70E-07, Aligned region: 556..575
T2SE [PF00437], Evalue: 1.30E-06, Aligned region: 183..228
T2SE [PF00437], Evalue: 1.30E-06, Aligned region: 553..628
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 18..104
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 203..305
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 423..487
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 556..581
RNA_helicase [PF00910], Evalue: 1.50E-05, Aligned region: 205..241
RNA_helicase [PF00910], Evalue: 1.50E-05, Aligned region: 557..578
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 201..229
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 559..579
Arch_ATPase [PF01637], Evalue: 3.00E-05, Aligned region: 184..266
Arch_ATPase [PF01637], Evalue: 3.00E-05, Aligned region: 557..574
Arch_ATPase [PF01637], Evalue: 3.00E-05, Aligned region: 618..638
Mg_chelatase [PF01078], Evalue: 4.70E-05, Aligned region: 190..242
Mg_chelatase [PF01078], Evalue: 4.70E-05, Aligned region: 556..578
ABC_tran [PF00005], Evalue: 6.10E-05, Aligned region: 204..242
ABC_tran [PF00005], Evalue: 6.10E-05, Aligned region: 405..466
ABC_tran [PF00005], Evalue: 6.10E-05, Aligned region: 557..594
Zeta_toxin [PF06414], Evalue: 6.50E-05, Aligned region: 200..235
Zeta_toxin [PF06414], Evalue: 6.50E-05, Aligned region: 556..606
AAA_29 [PF13555], Evalue: 0.0002, Aligned region: 203..227
AAA_29 [PF13555], Evalue: 0.0002, Aligned region: 555..569
PhoH [PF02562], Evalue: 0.00028, Aligned region: 190..230
PhoH [PF02562], Evalue: 0.00028, Aligned region: 556..577
Clp_N [PF02861], Evalue: 0.00039, Aligned region: 20..52
AAA_3 [PF07726], Evalue: 0.00087, Aligned region: 205..235
AAA_3 [PF07726], Evalue: 0.00087, Aligned region: 627..655
TIP49 [PF06068], Evalue: 0.0011, Aligned region: 202..244
TIP49 [PF06068], Evalue: 0.0011, Aligned region: 557..577
KaiC [PF06745], Evalue: 0.0015, Aligned region: 202..220
KaiC [PF06745], Evalue: 0.0015, Aligned region: 255..316
KaiC [PF06745], Evalue: 0.0015, Aligned region: 559..571
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 205..225
AAA_28 [PF13521], Evalue: 0.0015, Aligned region: 557..575
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 204..285
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 526..575
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 625..655
MobB [PF03205], Evalue: 0.0019, Aligned region: 205..230
MobB [PF03205], Evalue: 0.0019, Aligned region: 558..582
CbiA [PF01656], Evalue: 0.0027, Aligned region: 206..288
CbiA [PF01656], Evalue: 0.0027, Aligned region: 562..581
Sigma54_activ_2 [PF14532], Evalue: 0.0031, Aligned region: 200..238
Sigma54_activ_2 [PF14532], Evalue: 0.0031, Aligned region: 555..576
AAA_10 [PF12846], Evalue: 0.0034, Aligned region: 204..244
AAA_10 [PF12846], Evalue: 0.0034, Aligned region: 265..348
AAA_10 [PF12846], Evalue: 0.0034, Aligned region: 389..458
AAA_10 [PF12846], Evalue: 0.0034, Aligned region: 555..589
AAA_24 [PF13479], Evalue: 0.0036, Aligned region: 204..226
AAA_24 [PF13479], Evalue: 0.0036, Aligned region: 557..578
DNA_pol3_delta2 [PF13177], Evalue: 0.0039, Aligned region: 200..231
DNA_pol3_delta2 [PF13177], Evalue: 0.0039, Aligned region: 556..583
NB-ARC [PF00931], Evalue: 0.0044, Aligned region: 187..221
NB-ARC [PF00931], Evalue: 0.0044, Aligned region: 551..589
Torsin [PF06309], Evalue: 0.0045, Aligned region: 207..268
Torsin [PF06309], Evalue: 0.0045, Aligned region: 514..580
AAA_30 [PF13604], Evalue: 0.0049, Aligned region: 191..234
AAA_30 [PF13604], Evalue: 0.0049, Aligned region: 559..578
SRP54 [PF00448], Evalue: 0.005, Aligned region: 204..241
SRP54 [PF00448], Evalue: 0.005, Aligned region: 557..580
NTPase_1 [PF03266], Evalue: 0.0055, Aligned region: 205..231
NTPase_1 [PF03266], Evalue: 0.0055, Aligned region: 331..362
NTPase_1 [PF03266], Evalue: 0.0055, Aligned region: 557..577
ResIII [PF04851], Evalue: 0.0069, Aligned region: 196..228
ResIII [PF04851], Evalue: 0.0069, Aligned region: 266..318
ResIII [PF04851], Evalue: 0.0069, Aligned region: 555..578
AAA_23 [PF13476], Evalue: 0.008, Aligned region: 205..227
AAA_23 [PF13476], Evalue: 0.008, Aligned region: 254..270
AAA_23 [PF13476], Evalue: 0.008, Aligned region: 555..578
AAA_33 [PF13671], Evalue: 0.0086, Aligned region: 206..278
AAA_33 [PF13671], Evalue: 0.0086, Aligned region: 401..453
AAA_33 [PF13671], Evalue: 0.0086, Aligned region: 557..574
Protein Sequence: 816 a.a.     [Download]
>gi|256421339|ref|YP_003121992.1| ATPase AAA [Chitinophaga pinensis DSM 2588]
MTLTTYTIYAPEVQSAIRIAQALAKEHHHANYTPAHLLLACLHKEVGITPQLQAMNIDTYYLEEWAEVRL
DSVPKAGRLPEQPDADEYAANVLQEADAVRLEYDLDAADAWCVLVAISTPGVGFSFEQLKTFPLQRAQLL
SHFNKKDSNGAAPKTTIVTGKSVAQKYIYKLTDPQRLQAKHALAGRDAEVRTMMEILTRKGRSSILITGE
GGVGKTALADALASAILQKQAPLQLQQTDIYALDYGAFIAGAAYKNELEDRLQQIMSQLQEAGRHVLFID
NLHTLLDKQPGSAGGIGNVLKAAMNKGDITLIATSTPEGFRKLIEPDGLLRHCFEVVQLAEPDEATAARM
IQAVMPDYESYYNLKVAPEVISEAIKLSRRYLKERSLPDSAVNLLDRTLAAIRTTQDTGKITLDDLKAKL
EAAGDSREELRWWYQQCMQRYSALVTTRLQPQQDIYKIDNEAALKTALLDIIAQLEPLVETQHVAVTGID
LATMIAESTGIPLGKIQSGERERLVNMDLELRKRVVGQDHALKTVSEAILESRSGLSRPGQPIGSFFFLG
PTGTGKTELAKSLADFLFQDERCMIRFDMSEFKEEHSAALLYGAPPGYVGYEEGGLLVNKIRQQPYAVVL
FDEIEKAHPSVFDIFLQIMDEGKLHDRLGKTGDFSNALILFTSNIGSDVIAQSFRQGVIPASQQLMEIMA
RNFRPEFLGRLTEIVPFGPIQQENVVKIFDIHLKHLLQLLTQQQITLDVSVAAREKLAAEGYSPLYGARP
LKEVIRSRLRKPLSRMIIEGSLQPHTTVKLDIDAQGELQWQAGAQG
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|256419057|ref|NC_013132.1|:2833322-2835772 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGACCCTGACTACATATACCATATATGCTCCTGAGGTGCAATCTGCTATTCGCATTGCACAGGCACTGG
CCAAAGAACATCACCATGCTAATTATACGCCTGCCCACTTATTGCTGGCATGTCTGCACAAGGAAGTCGG
AATAACGCCGCAGCTACAGGCAATGAACATCGATACTTATTACCTGGAAGAATGGGCAGAGGTAAGACTG
GATAGTGTCCCGAAAGCAGGCCGTTTACCAGAACAGCCGGACGCAGACGAATATGCAGCGAATGTGCTGC
AGGAAGCAGATGCCGTAAGACTGGAATACGATCTCGATGCAGCTGACGCCTGGTGCGTACTTGTTGCTAT
CAGCACGCCTGGGGTAGGCTTCTCTTTCGAGCAACTGAAAACATTTCCTTTGCAGCGGGCTCAATTACTC
TCGCATTTCAACAAGAAAGATAGTAACGGCGCAGCGCCCAAGACGACCATCGTCACCGGCAAAAGCGTCG
CACAGAAATATATTTATAAACTCACAGATCCGCAGCGACTCCAGGCGAAACATGCACTGGCTGGCCGCGA
TGCGGAAGTGCGTACGATGATGGAAATACTGACCCGTAAAGGACGTTCCAGTATTCTTATCACGGGAGAA
GGCGGCGTGGGTAAAACCGCACTGGCAGATGCACTGGCAAGCGCTATTTTGCAAAAACAAGCACCTTTGC
AATTGCAGCAAACCGATATCTATGCACTGGATTATGGTGCATTCATAGCAGGAGCTGCGTATAAAAATGA
GCTGGAAGACAGATTGCAACAGATCATGTCACAATTGCAGGAAGCTGGTCGCCATGTACTGTTCATCGAC
AATCTGCACACCCTGCTGGATAAACAGCCGGGATCTGCGGGAGGCATCGGCAATGTACTGAAAGCAGCGA
TGAACAAGGGCGATATCACACTTATTGCTACCAGTACTCCGGAAGGTTTCCGTAAACTGATAGAGCCGGA
TGGCCTGCTGCGTCACTGTTTTGAAGTAGTGCAACTGGCAGAGCCGGATGAAGCAACAGCTGCCCGTATG
ATACAGGCAGTAATGCCGGATTATGAAAGCTACTATAACTTAAAAGTAGCGCCGGAAGTGATCAGTGAAG
CGATTAAACTGTCACGCCGTTATCTGAAGGAAAGAAGTTTACCGGATAGCGCTGTGAACCTGCTGGACCG
TACACTGGCCGCCATCCGTACCACCCAGGATACCGGAAAGATTACACTGGATGATCTGAAAGCAAAACTG
GAAGCGGCAGGTGATAGCCGGGAAGAACTGCGCTGGTGGTATCAGCAATGTATGCAGCGTTATAGTGCAT
TGGTCACTACACGTCTGCAACCACAGCAGGACATTTACAAAATTGACAATGAAGCTGCCCTGAAAACAGC
TTTGCTCGATATCATTGCGCAGCTGGAACCATTGGTAGAAACACAGCACGTCGCCGTGACAGGTATCGAC
CTGGCCACGATGATTGCGGAAAGTACCGGTATTCCATTGGGTAAGATCCAGTCAGGCGAACGTGAGCGCC
TGGTGAATATGGACCTCGAATTGCGGAAGAGAGTGGTGGGGCAGGATCATGCCCTTAAAACAGTCTCCGA
AGCCATCCTGGAATCACGTTCCGGTCTCAGCAGACCAGGACAGCCAATAGGCTCATTTTTCTTCCTGGGG
CCGACCGGAACCGGGAAAACGGAATTAGCGAAATCTTTGGCAGACTTCTTGTTCCAGGATGAACGGTGCA
TGATCAGATTTGACATGTCCGAATTTAAAGAAGAACACTCGGCGGCATTACTATATGGCGCTCCGCCGGG
CTACGTGGGATATGAAGAAGGGGGCCTGCTGGTAAATAAAATCCGCCAGCAACCTTATGCCGTAGTATTG
TTTGACGAAATCGAAAAAGCGCATCCATCAGTATTCGATATTTTCCTCCAGATAATGGACGAGGGCAAAT
TGCATGACCGCCTGGGTAAAACCGGTGATTTTTCAAATGCCCTGATCCTGTTTACATCCAACATCGGTAG
TGATGTGATCGCCCAGTCATTCAGACAGGGAGTGATCCCCGCCTCGCAACAACTGATGGAGATTATGGCC
AGAAATTTCAGACCCGAATTTCTGGGCAGGCTGACAGAGATCGTTCCATTTGGTCCCATTCAGCAGGAAA
ATGTCGTGAAGATTTTTGATATCCATTTAAAACATCTGCTGCAATTGTTAACGCAGCAGCAAATAACCCT
CGACGTTTCTGTCGCCGCAAGAGAAAAGCTGGCAGCAGAAGGGTATTCGCCGTTATATGGCGCACGTCCA
TTGAAAGAAGTGATCCGGAGCAGACTGAGAAAGCCCTTGTCACGAATGATCATTGAAGGCAGTCTGCAGC
CCCATACGACCGTTAAACTGGATATTGACGCTCAGGGTGAGCTACAATGGCAAGCCGGCGCGCAGGGATG
A