SecReT6
Protein ID: 256421340
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2301
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2835829..2836275 [+]
Producthypothetical protein
NoteTssB
UniProt IDC7PG60
KEGG IDcpi:Cpin_2301
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 148 a.a.     [Download]
>gi|256421340|ref|YP_003121993.1| hypothetical protein Cpin_2301 [Chitinophaga pinensis DSM 2588]
MNDNYGIGGNEVKLDANEAIVEISHNRTLFAEKLTQQTPVKPEIVQGLTTVEGVFEHYKPAVNMLFHDAE
GRTVPENLEFHNLGDFGIKGITAQSTFLDNLATEKEQYLKIMKHLKTNKVLKAALADPAARQALLESIRS
LVADLEKK
 
Nucleotide Sequence: 447 bp     [Download]
>gi|256419057|ref|NC_013132.1|:2835829-2836275 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGAATGACAATTACGGGATTGGTGGTAATGAGGTGAAACTCGACGCCAATGAAGCCATTGTTGAGATCT
CTCATAACCGGACCCTGTTTGCTGAAAAGTTGACCCAGCAAACGCCTGTTAAACCGGAAATCGTGCAGGG
ACTTACCACTGTAGAAGGAGTATTTGAACATTACAAACCGGCTGTAAACATGCTGTTTCATGATGCAGAA
GGACGTACTGTTCCGGAAAACCTGGAATTCCACAACCTGGGCGACTTCGGTATTAAAGGAATTACCGCAC
AGAGTACATTCCTCGACAACCTTGCCACAGAAAAAGAACAGTATTTGAAAATCATGAAACACCTTAAAAC
AAATAAGGTGCTGAAAGCTGCTCTTGCCGATCCTGCTGCCCGACAGGCCCTGCTGGAATCGATAAGATCA
CTGGTGGCTGATCTTGAAAAGAAATGA