SecReT6
Protein ID: 256421341
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2302
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2836461..2837837 [+]
Producthypothetical protein
NoteTssC
UniProt IDC7PG61
KEGG IDcpi:Cpin_2302
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.80E-16, Aligned region: 122..261
DUF877 [PF05943], Evalue: 5.80E-16, Aligned region: 287..433
Phage_sheath_1 [PF04984], Evalue: 6.30E-05, Aligned region: 308..438
Protein Sequence: 458 a.a.     [Download]
>gi|256421341|ref|YP_003121994.1| hypothetical protein Cpin_2302 [Chitinophaga pinensis DSM 2588]
MAELQKQQEQQDQLQNAPSQQTASSLQENIDILAKFGGFDLLEGAIEGVQNLNPDRKARRNIFLTESTKK
GERDKLKKTLELWEKVLTEAQDLPDMVSFCTEHSEQSERVLNSNLGEAVEATRELEQSYRNVALFFKNTE
SDKVKNVAFINVEQDQLKDLDNTRFIDAIHQELVSNYDRLDLRDNYSLLVIPGYLGSNKVLEKWAKIAYE
NKTMLITDFSHLDAPDDVMEMFELANLTGGEIHRSNVMMTCNWLVGRGKFDEINEQDNLYIPPSGALAGK
VYKTLMSQVTAGKKFGGMNEVDGVKFELKKSEIAGLEKMGLIPMVKEYGKVMAFSAKTLFNGDNIGLQTY
SVVRVFDYVTKVLMDFLNRRAFENFNANTRKDLMKQIIRFLDSITGPDKLIEDFNVRRFEQDPIQKDRIH
LNIHLKPYFPAKNFLIKMEGHKGEDATEWDTEYEQDKA
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|256419057|ref|NC_013132.1|:2836461-2837837 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGGCTGAATTACAAAAACAGCAGGAGCAGCAGGACCAGCTGCAGAATGCGCCCTCCCAACAAACTGCTT
CTTCTCTACAGGAGAATATAGATATACTGGCCAAATTTGGTGGTTTTGACCTGCTTGAAGGTGCGATCGA
AGGTGTACAAAACCTGAACCCCGATCGTAAAGCACGTCGTAATATATTTCTTACAGAAAGCACCAAAAAA
GGTGAACGCGATAAGCTGAAAAAAACACTCGAACTCTGGGAAAAAGTTCTGACCGAAGCGCAGGATCTAC
CTGATATGGTGAGCTTCTGTACTGAACATTCAGAACAGTCAGAGCGCGTATTGAATAGCAACCTCGGAGA
AGCGGTAGAAGCTACCCGTGAACTGGAACAGTCTTACCGTAATGTGGCTTTGTTCTTCAAAAATACCGAG
TCAGATAAGGTAAAGAATGTGGCTTTTATCAACGTGGAACAGGACCAGCTGAAAGACCTGGACAACACCC
GTTTCATCGATGCCATACACCAGGAATTAGTGAGCAACTACGATCGTCTGGACCTGCGTGATAACTATAG
TCTGCTGGTTATTCCAGGCTATCTTGGTTCAAACAAAGTACTGGAAAAATGGGCGAAGATCGCTTATGAA
AATAAGACGATGCTCATTACAGACTTCTCTCACCTGGATGCACCAGATGATGTGATGGAAATGTTTGAAC
TGGCTAACCTCACCGGCGGTGAAATACACAGGTCTAATGTTATGATGACCTGTAACTGGCTGGTAGGTCG
TGGTAAGTTTGATGAAATTAACGAACAGGATAACCTGTACATACCACCATCAGGCGCACTGGCTGGTAAA
GTATATAAAACACTGATGTCACAGGTAACTGCCGGTAAGAAATTCGGTGGTATGAATGAAGTAGACGGTG
TGAAATTTGAACTGAAGAAGAGCGAAATTGCAGGTCTGGAGAAAATGGGGCTGATACCCATGGTAAAGGA
ATATGGAAAAGTAATGGCGTTTAGTGCAAAGACTTTGTTTAACGGTGATAATATCGGTTTGCAGACTTAT
TCCGTAGTACGTGTATTCGACTACGTGACGAAGGTGTTGATGGACTTCCTGAACCGCCGTGCATTTGAAA
ATTTCAATGCCAACACCCGTAAAGATCTGATGAAACAGATTATCCGGTTCCTTGACAGCATTACCGGTCC
TGATAAACTGATAGAGGACTTTAACGTACGCAGATTTGAACAGGATCCTATACAAAAAGATCGTATCCAC
CTCAATATTCACCTGAAACCATACTTCCCGGCTAAGAACTTCCTGATCAAAATGGAAGGACATAAAGGGG
AAGATGCGACAGAATGGGATACTGAATACGAGCAGGATAAAGCATAA