SecReT6
Protein ID: 256421344
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2305
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2840091..2841923 [-]
Producthypothetical protein
NoteTssF
UniProt IDC7PG64
KEGG IDcpi:Cpin_2305
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 610 a.a.     [Download]
>gi|256421344|ref|YP_003121997.1| hypothetical protein Cpin_2305 [Chitinophaga pinensis DSM 2588]
MPREQKERIKDRMLKTAARLWGYPDAEVESSFDPIVQLLLEACSSELEKISGEVDVSHARLVERLAQIMM
PEPITSSQPAYGVLHAGSNEPSTVIDAEHQLFYTSKSGFNSKDLFFMPLTRHRLFRGQVKYMAIGNRLFE
TRDHWFKEQILQGNLQADTPPNHLWIGLSLEGSPSSIEEMSFFFDLRNVHQQEMFYYYLPLARFYLNDTE
LTIKSGYSQSQDAAAEDVDNIMHPAFDTNTRYSQQILHRFRHQFLTISKHTSLPLQSPAPETLQHIFGAA
FNKIQPNTHWIRIEFPETIRHTLLEDLFCNINCFPVVNKRVNEQSQRLNRYLNIMPLHTADIYFDVKRVH
DTSGTDYHVRNFTTAGEMQEGELVVRSSGIGRFDTREAKEIIAYLIEVIRDESSLFEEVRNDYVANRIRE
LHQLIASLEEQLQPSVNRGNIPYLMVKPREEADFLFIEFFTTNGSVANNIRMGTRLQEYGSVQLQPGSIT
LLSNTQGGKDRLSIDEKVNLYRYHLLSRDRVVTPEDIKALCRYVVGNELRNVSVAKGVSVLPGATEGYTR
TLDIRLTLSQPTTAYAAVNLVYLKDELLSQLKERSANNYPYRIYMNEVLM
 
Nucleotide Sequence: 1833 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c2841923-2840091 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGCCAAGAGAACAAAAAGAAAGGATAAAAGACCGGATGCTCAAAACGGCCGCCCGACTCTGGGGATATC
CGGATGCAGAAGTGGAATCTTCTTTTGATCCCATTGTACAACTCCTGCTGGAAGCCTGTTCCAGTGAACT
TGAAAAAATATCAGGCGAAGTAGATGTGTCTCATGCAAGACTGGTAGAAAGACTGGCGCAGATCATGATG
CCGGAACCCATCACCAGCAGTCAGCCTGCTTACGGTGTATTACATGCCGGCAGTAATGAACCATCTACCG
TGATAGATGCAGAACACCAGCTGTTCTATACTTCAAAAAGCGGCTTCAATTCAAAAGACCTTTTCTTCAT
GCCCCTGACCAGGCATCGCCTGTTCCGCGGACAGGTCAAATATATGGCCATCGGCAACCGTCTTTTTGAA
ACGCGTGATCACTGGTTTAAAGAACAGATTCTGCAGGGTAATCTGCAGGCTGATACCCCGCCCAATCATT
TATGGATAGGTCTGTCCCTGGAAGGCAGTCCTTCCTCAATTGAAGAAATGTCCTTTTTCTTTGACCTCAG
AAACGTTCATCAGCAGGAGATGTTTTACTACTATCTCCCACTGGCGCGCTTCTATCTCAATGATACGGAA
CTGACCATAAAAAGTGGCTATAGCCAGAGCCAGGACGCCGCTGCTGAAGATGTTGATAATATCATGCATC
CTGCCTTTGATACCAACACCCGTTACAGCCAGCAGATCCTGCACCGTTTCCGCCATCAGTTTCTGACCAT
CAGTAAACACACCTCGCTTCCGCTGCAATCACCTGCACCGGAAACGTTGCAACATATATTCGGAGCCGCA
TTCAATAAAATCCAGCCCAATACACACTGGATCAGAATTGAATTCCCTGAAACTATCCGGCATACATTAC
TGGAAGATCTTTTCTGCAACATCAATTGCTTCCCTGTCGTCAATAAACGCGTCAATGAACAGTCACAGCG
CCTGAACCGTTATCTCAACATCATGCCGCTGCATACTGCTGATATCTACTTTGATGTTAAACGTGTACAT
GATACCAGCGGAACCGACTATCATGTACGTAACTTCACGACAGCCGGAGAAATGCAGGAAGGCGAACTGG
TTGTGCGTAGCAGCGGTATCGGCAGATTTGATACCCGCGAGGCAAAAGAAATCATCGCCTACCTCATTGA
AGTGATCCGTGATGAAAGTTCGCTTTTTGAAGAAGTACGTAACGACTATGTCGCCAACCGCATCCGTGAA
TTACATCAGCTGATTGCCTCCCTGGAAGAACAATTACAACCCAGCGTCAATCGTGGTAACATTCCATACC
TAATGGTGAAACCACGCGAGGAGGCTGATTTCCTGTTTATAGAGTTCTTTACCACAAATGGTAGTGTAGC
GAATAATATCCGTATGGGCACGCGTTTGCAGGAGTATGGCAGCGTACAGTTACAACCGGGTTCTATCACG
CTTCTTTCCAATACACAGGGTGGTAAAGACCGTCTCAGCATCGACGAAAAAGTAAACCTTTACCGTTATC
ACCTGCTTAGCCGGGACCGTGTAGTAACACCGGAAGATATCAAAGCGCTCTGCCGTTATGTGGTTGGTAA
TGAACTACGCAATGTAAGTGTTGCCAAAGGTGTTTCTGTATTACCCGGCGCTACGGAAGGATATACCAGA
ACACTGGATATCAGGTTAACATTATCGCAACCTACAACTGCTTATGCGGCGGTGAACCTCGTGTATCTCA
AAGATGAATTATTATCACAGCTGAAGGAGCGTTCAGCCAACAATTATCCTTACAGAATCTATATGAATGA
GGTGTTGATGTGA