SecReT6
Protein ID: 256421345
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2306
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2841933..2842364 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDC7PG65
KEGG IDcpi:Cpin_2306
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.00E-15, Aligned region: 24..127
Protein Sequence: 143 a.a.     [Download]
>gi|256421345|ref|YP_003121998.1| GPW/gp25 family protein [Chitinophaga pinensis DSM 2588]
MKKEYYKLPLDFSRILQKKDLPDCNLEDSVAQHIQLLITTVLGENKDDPQYGCRIWDFDFDIRASNNEVK
EQVELSVKSAIVRYEQRITQVRVSAMVSQEELNGISAKKVKKKIRVTITGTLARNKTPFHYSSFFYVSPL
SYD
 
Nucleotide Sequence: 432 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c2842364-2841933 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGAAGAAAGAGTATTATAAACTGCCGCTTGACTTTTCCCGGATCCTGCAAAAAAAGGACCTTCCTGACT
GCAACCTGGAAGACTCCGTAGCCCAACATATACAACTGCTCATTACAACCGTACTTGGGGAAAACAAAGA
CGATCCCCAGTACGGTTGCCGGATATGGGATTTCGACTTTGACATCCGGGCTTCCAACAACGAAGTTAAG
GAACAGGTGGAACTCTCCGTAAAAAGTGCCATCGTGCGTTATGAACAACGTATCACGCAGGTAAGGGTTT
CTGCCATGGTCAGCCAGGAAGAACTGAACGGCATCAGCGCCAAAAAAGTCAAGAAAAAGATACGGGTGAC
TATCACCGGTACCCTGGCCCGCAATAAAACTCCATTCCATTACAGCAGCTTCTTTTATGTAAGTCCGCTG
TCGTACGATTAA