SecReT6
Protein ID: 256421346
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2307
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2842383..2843453 [-]
ProductPKD domain-containing protein
NoteTssP
UniProt IDC7PG66
KEGG IDcpi:Cpin_2307
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 3.20E-13, Aligned region: 70..123
PKD [PF00801], Evalue: 3.20E-13, Aligned region: 159..206
Protein Sequence: 356 a.a.     [Download]
>gi|256421346|ref|YP_003121999.1| PKD domain-containing protein [Chitinophaga pinensis DSM 2588]
MTPRKTQNERKVSTYRPFSKITSHIDPMVLYTFLSLLVISIVLLAFQASNREVCTDAAIVLASQQRAGKS
TTFTAGEVITFRADLKGGGVAGVNWDFGDSTASAPGVQVYHAFSKAGIYTVILHRGKCDWRQEVIVINAA
PERAPDTRGDIYPVIEGPEEVFIGRPVTFTNHTPGATSWSWQLLQPNAEVHSGNSVKYTFGSPGERILSL
IVNGDSSKMVTKRISVFDAAPQRPRNDHFDPIPFPEDPKPVDPNAGAAPVPDKPKTPSVSDDEFKFFLTQ
VVDKQKSASDFSPYLCDNMNARVLLNDKDTDTFAHFCSRIRGKKRFKIELVNLIKDQNGCVKEIRVRYDR
KFLGIF
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c2843453-2842383 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGACCCCGCGCAAGACCCAAAATGAGCGTAAAGTAAGTACGTATAGACCCTTTAGCAAGATTACAAGCC
ACATTGACCCAATGGTGTTGTATACATTCCTGTCTTTACTGGTAATCAGCATCGTTTTGCTGGCATTCCA
GGCATCTAATAGAGAAGTATGTACAGACGCTGCCATTGTGTTAGCCAGCCAGCAACGTGCGGGTAAATCC
ACCACATTTACAGCTGGTGAAGTCATCACTTTCAGAGCCGATCTCAAAGGCGGCGGCGTGGCCGGCGTCA
ACTGGGATTTCGGAGATTCTACCGCCTCAGCTCCGGGTGTACAGGTATATCATGCTTTCAGTAAAGCGGG
CATTTACACTGTTATCCTCCATCGCGGAAAGTGCGACTGGCGACAGGAAGTGATCGTTATCAATGCTGCT
CCCGAAAGAGCGCCTGATACCCGTGGCGATATCTACCCGGTGATCGAAGGTCCGGAAGAAGTCTTCATCG
GCCGTCCCGTAACCTTCACCAACCATACGCCCGGCGCCACCAGCTGGTCCTGGCAGTTACTCCAGCCTAA
TGCGGAAGTGCATTCCGGCAATTCTGTAAAATATACCTTCGGCTCTCCTGGTGAACGGATTCTGTCCCTG
ATCGTAAACGGAGACAGCAGTAAAATGGTGACCAAACGTATCTCGGTCTTTGATGCGGCTCCTCAACGCC
CCAGAAATGACCATTTTGACCCCATTCCTTTCCCTGAAGACCCTAAACCGGTCGATCCTAACGCGGGTGC
TGCTCCGGTGCCGGATAAGCCTAAAACACCGTCTGTTTCTGATGATGAATTTAAGTTCTTCCTTACACAA
GTTGTAGACAAACAAAAAAGCGCCTCCGATTTCTCCCCCTACCTCTGCGATAACATGAACGCAAGGGTGC
TGCTGAACGATAAAGACACTGACACTTTTGCACATTTTTGTTCCCGCATCAGGGGTAAGAAGCGTTTCAA
AATTGAGCTTGTCAACCTCATCAAGGACCAGAATGGTTGTGTGAAAGAAATCAGGGTAAGATATGACAGG
AAATTCCTTGGTATATTCTAA