SecReT6
Protein ID: 256421347
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2308
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2843606..2844559 [+]
Producthypothetical protein
NoteTssG
UniProt IDC7PG67
KEGG IDcpi:Cpin_2308
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.30E-07, Aligned region: 114..316
Protein Sequence: 317 a.a.     [Download]
>gi|256421347|ref|YP_003122000.1| hypothetical protein Cpin_2308 [Chitinophaga pinensis DSM 2588]
MVNNAQKAAVLEEVIDHIRRLHYDVRAEVVVGELLDNDVQESEVAVQMQNVFTRAFNKDILDAQLDDSQP
YHPFITLTLSRDGLYDRLPEGLFHEFTAQKQQEVSEMVANYKKHQQEEQEARKFFRPLEHEFFLQRVFLE
QREKHLLFDALGKDADELFLSFWGIPDGLPKEPVNKLIRLLPYIHRIAGNLPLVQLYLQAILDEPVAITC
ENGPVAVSSGIQTGLGECRLGVDTMTGSLFYTDMPRVIVKVGPLQHRRVYDFLSWQPYGKLLETCLGFLL
PADVEAETLLEPHPDEKQVVVNDSRHKEGLMGYNFFL
 
Nucleotide Sequence: 954 bp     [Download]
>gi|256419057|ref|NC_013132.1|:2843606-2844559 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGGTAAATAATGCCCAAAAAGCCGCAGTGCTCGAAGAAGTGATCGATCACATACGTCGTCTCCATTATG
ACGTACGCGCAGAAGTTGTTGTGGGAGAACTGCTGGACAATGATGTGCAGGAGTCGGAAGTAGCCGTACA
GATGCAGAACGTTTTTACAAGAGCTTTCAATAAAGATATCTTAGATGCACAATTAGATGATTCACAGCCA
TATCATCCTTTCATTACTTTAACACTCTCCCGTGACGGCCTGTATGACCGGTTACCGGAAGGCCTTTTTC
ACGAGTTTACGGCCCAGAAACAGCAGGAAGTCAGCGAAATGGTAGCTAACTACAAAAAGCACCAGCAAGA
GGAACAGGAGGCCCGTAAATTCTTCCGTCCGCTGGAGCATGAATTTTTCCTGCAACGTGTATTTTTAGAG
CAGAGAGAGAAGCACCTGTTATTTGATGCACTGGGAAAGGATGCAGATGAATTATTTTTATCTTTCTGGG
GCATTCCGGATGGATTACCCAAAGAACCGGTGAATAAACTTATCAGGTTATTACCGTATATTCATCGTAT
AGCAGGCAACCTGCCTTTGGTGCAGTTATACCTGCAGGCGATACTGGACGAACCAGTAGCCATTACATGT
GAAAACGGACCTGTTGCCGTATCCTCAGGTATACAAACCGGCCTCGGAGAATGCAGGCTGGGGGTGGATA
CGATGACAGGAAGTCTTTTTTATACCGATATGCCTAGAGTCATTGTGAAAGTAGGTCCTCTGCAACATCG
CCGGGTATACGATTTCCTGTCCTGGCAACCGTATGGTAAATTACTGGAAACCTGCCTGGGCTTTCTTTTG
CCGGCGGATGTTGAAGCCGAAACTTTACTGGAGCCACATCCGGATGAAAAACAAGTAGTTGTAAACGATA
GCCGCCATAAGGAAGGATTAATGGGATATAATTTTTTCCTATAG