SecReT6
Protein ID: 256421348
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2309
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2844636..2845496 [+]
Producthypothetical protein
NoteTssN
UniProt IDC7PG68
KEGG IDcpi:Cpin_2309
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 286 a.a.     [Download]
>gi|256421348|ref|YP_003122001.1| hypothetical protein Cpin_2309 [Chitinophaga pinensis DSM 2588]
MILKAKIYLVLAAIMAVGALIVGLLSRYIKNFTLYKKKALWYLFLLTLVFAVISSIPFLFTHQNLVSQYL
FYQVWFLGLGIAHCHIMYTRFWANERTLTSELAFIVAIYLFGGVGFMLVQFLFTKGDFLYYPMLTCFLAF
ALPTFVYKTFEKMMAIPAKVHKWWQYPAYHEQPEVNEDDMKDLIVIGFELEKNTKDQDRTYFRARTPIKM
DLGDLFYHFVNDYNDRYPNTPIDVLDKNGQPYGWVFHLKSKWLGIARTLDPEKPVFMNGMQENSVIICNR
VMLSNN
 
Nucleotide Sequence: 861 bp     [Download]
>gi|256419057|ref|NC_013132.1|:2844636-2845496 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGATACTTAAAGCAAAAATTTATCTTGTATTAGCCGCTATCATGGCGGTAGGCGCTCTTATCGTGGGAC
TGCTGAGTCGTTATATTAAAAACTTTACCCTATATAAGAAAAAGGCATTGTGGTATCTGTTCCTGCTCAC
GCTTGTATTTGCTGTGATCAGCTCGATACCTTTTCTGTTTACCCATCAGAATCTGGTCAGCCAATATTTG
TTTTACCAGGTGTGGTTCCTCGGATTGGGGATAGCACACTGCCACATCATGTATACCCGTTTCTGGGCTA
ATGAGCGTACCCTGACCTCAGAACTGGCCTTTATTGTGGCCATTTATCTGTTTGGGGGCGTGGGCTTTAT
GCTGGTACAGTTCCTTTTCACCAAAGGTGACTTTTTGTATTATCCCATGCTGACCTGTTTCCTGGCTTTT
GCCTTGCCCACTTTTGTATACAAGACCTTCGAAAAGATGATGGCTATTCCTGCGAAAGTGCATAAATGGT
GGCAATATCCAGCGTATCATGAGCAGCCGGAAGTGAATGAAGATGATATGAAAGATCTGATCGTAATCGG
CTTCGAATTAGAGAAGAATACCAAGGATCAGGATCGTACTTATTTCAGGGCTCGTACCCCCATTAAAATG
GACCTGGGCGACCTGTTTTATCACTTTGTGAATGACTATAACGACCGTTACCCCAATACACCGATAGATG
TACTCGATAAGAACGGGCAGCCTTATGGGTGGGTGTTTCACCTGAAATCAAAATGGCTGGGCATAGCGCG
TACACTTGATCCCGAAAAGCCTGTTTTCATGAACGGAATGCAGGAAAATAGTGTGATCATCTGTAACAGG
GTTATGCTGAGTAACAATTAA