SecReT6
Protein ID: 256421349
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2310
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2845542..2846717 [+]
Producthypothetical protein
NoteTssK
UniProt IDC7PG69
KEGG IDcpi:Cpin_2310
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.70E-06, Aligned region: 73..95
DUF876 [PF05936], Evalue: 6.70E-06, Aligned region: 176..250
DUF876 [PF05936], Evalue: 6.70E-06, Aligned region: 324..353
Protein Sequence: 391 a.a.     [Download]
>gi|256421349|ref|YP_003122002.1| hypothetical protein Cpin_2310 [Chitinophaga pinensis DSM 2588]
MAEPLKYFPVNWVDGMKIKKQHFIETENAMLDQIRDAISSGLHAQNYGLLPAKAESKESLRCWFVTDNQH
QWRVKLTECRAVTPGGARIEIPEHTVHSLKYATTFPEISYWWDPQHTEAAYYILIQVDPFDRQPSGEPLL
HEDPPRLPNATPEYELFIQPASQMPQGQLGAYQMILGRITVKDGRPQLDDDYIPPTSLVSAHPALADLHQ
ELDQFLGYLELHGVQIVQKIYGKNQNNDLAQVVLYITERMVQYLGTRISQFRWLGLYQSPAEMLEVVAGL
SRTMKNAIDLRAHTGKEELLNYLSEWCELRQGELETLMVNCSNIRYKHTDVRECLEPMIPFVRAISKLFE
SLSRLDYIGSKTDKGIFVKEESAEDSEYLRKHKTKRWFFTD
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|256419057|ref|NC_013132.1|:2845542-2846717 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGGCAGAACCGCTCAAATATTTTCCCGTCAACTGGGTGGATGGAATGAAAATTAAGAAGCAGCATTTCA
TTGAAACTGAAAATGCAATGCTTGATCAGATCCGGGATGCTATATCCAGCGGTTTGCATGCGCAGAACTA
TGGACTATTGCCGGCTAAAGCAGAGAGTAAGGAATCCCTTCGCTGCTGGTTCGTAACAGATAATCAGCAT
CAGTGGCGCGTCAAACTTACAGAGTGCCGTGCAGTAACGCCTGGAGGAGCACGCATCGAGATCCCGGAAC
ATACCGTACATTCTTTGAAGTATGCAACTACATTTCCTGAAATATCTTACTGGTGGGATCCGCAGCATAC
AGAAGCTGCTTACTACATTCTGATACAGGTGGATCCATTTGACCGTCAGCCAAGTGGTGAACCGCTGTTG
CACGAAGATCCGCCACGTTTGCCAAATGCTACGCCGGAATATGAGTTGTTCATACAACCTGCATCACAGA
TGCCACAGGGCCAGTTAGGCGCCTATCAGATGATACTGGGACGTATTACCGTGAAGGATGGACGTCCGCA
GCTGGATGATGATTATATCCCACCTACCAGTCTTGTATCAGCGCATCCTGCACTGGCGGATCTGCATCAG
GAACTGGACCAGTTCCTCGGTTACCTGGAATTGCATGGTGTACAGATCGTGCAGAAAATCTATGGTAAAA
ACCAGAACAATGATCTGGCGCAGGTGGTATTGTACATCACGGAAAGAATGGTGCAATACCTCGGTACGCG
TATCTCACAGTTCCGCTGGTTAGGATTGTATCAGTCGCCCGCAGAGATGCTGGAAGTAGTAGCAGGATTG
TCCAGAACCATGAAAAACGCCATCGACTTACGAGCGCATACAGGTAAGGAAGAACTGCTGAATTATCTTT
CAGAATGGTGTGAACTGAGACAGGGAGAACTGGAAACACTGATGGTGAACTGTTCGAATATACGTTATAA
GCATACAGATGTAAGAGAATGTCTGGAGCCTATGATACCTTTCGTACGTGCGATCAGTAAACTGTTTGAA
AGTCTCAGCAGACTGGATTACATCGGCAGCAAAACGGACAAGGGCATCTTTGTCAAGGAAGAATCTGCGG
AAGATTCTGAATACCTGCGCAAGCATAAAACCAAAAGATGGTTTTTCACAGATTGA