SecReT6
Protein ID: 256421350
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2311
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2846740..2847252 [+]
Producthypothetical protein
NoteTssO
UniProt IDC7PG70
KEGG IDcpi:Cpin_2311
PDB IDNA
Domain hit(s) vs Pfam Sec8_exocyst [PF04048], Evalue: 0.0041, Aligned region: 59..76
Sec8_exocyst [PF04048], Evalue: 0.0041, Aligned region: 108..161
Protein Sequence: 170 a.a.     [Download]
>gi|256421350|ref|YP_003122003.1| hypothetical protein Cpin_2311 [Chitinophaga pinensis DSM 2588]
MRVLNKQERTAAFLWFLLFFVVSVGLFVLAIFFNYQVPAKENDDLRKQLTSFRQEQAFQGDFLQRMDKVK
NNLDSINLPNQNANYMDQVVAQDLVTMRNSIPKESVTHYGLYNNIIQNLLSIQQGKQQMRGLQNAQQTIA
ELKEKIADLNRELETTRNELDYNRQMMRSR
 
Nucleotide Sequence: 513 bp     [Download]
>gi|256419057|ref|NC_013132.1|:2846740-2847252 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGCGTGTACTAAACAAACAGGAGAGAACAGCTGCATTTCTTTGGTTCCTTCTTTTCTTTGTCGTTTCAG
TTGGTCTGTTCGTACTGGCCATATTTTTTAACTATCAGGTGCCTGCAAAAGAGAATGACGATCTGCGTAA
ACAGTTGACTTCATTCCGCCAGGAGCAGGCGTTTCAAGGAGATTTTCTGCAAAGGATGGACAAGGTGAAA
AATAATCTGGACTCTATTAATCTGCCCAATCAGAATGCAAATTATATGGACCAGGTAGTAGCGCAGGATC
TTGTTACAATGCGTAACAGTATTCCGAAAGAATCAGTAACGCACTACGGACTGTACAATAACATCATTCA
GAATCTTTTGTCTATTCAACAGGGCAAGCAACAAATGAGAGGATTGCAGAACGCCCAGCAGACAATAGCA
GAGCTGAAAGAGAAGATTGCCGATCTCAACCGCGAGCTGGAAACAACGCGTAATGAGCTTGATTATAACA
GACAAATGATGCGATCAAGATGA