SecReT6
Protein ID: 256421351
SecReT6 ID912
T6SS typeiii
Gene symbol-
Locus tagCpin_2312
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]2847367..2847753 [+]
Producthypothetical protein
NoteHcp
UniProt IDC7PG71
KEGG IDcpi:Cpin_2312
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|256421351|ref|YP_003122004.1| hypothetical protein Cpin_2312 [Chitinophaga pinensis DSM 2588]
MSFKSVFEVAGKKLVVKHCSYDLTQEVDATGRPSAITRGGRIRLIVESTGETDLFEWMVNNFERKDGTIT
FYKRDSDAQLKQLSFKEGYLVKFEESFDADDKNPMSVSFTISARELSMGSGTHINEWV
 
Nucleotide Sequence: 387 bp     [Download]
>gi|256419057|ref|NC_013132.1|:2847367-2847753 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGTCCTTCAAATCAGTGTTTGAAGTAGCTGGCAAAAAATTGGTGGTAAAACACTGCAGCTATGACCTCA
CCCAAGAAGTAGACGCTACCGGTCGCCCTTCGGCAATCACACGTGGTGGCAGAATCCGTTTAATTGTTGA
ATCAACAGGAGAAACAGATCTCTTTGAATGGATGGTAAACAACTTTGAAAGAAAAGATGGTACCATTACT
TTCTACAAGAGAGACTCTGATGCTCAGTTGAAACAATTATCCTTCAAAGAAGGCTATCTGGTAAAGTTTG
AAGAGTCTTTTGACGCTGACGACAAAAACCCGATGAGCGTTTCATTCACCATTTCAGCCCGTGAATTAAG
TATGGGCAGTGGCACCCATATTAACGAATGGGTTTGA