SecReT6
Protein ID: 256423848
SecReT6 ID913
T6SS typeiii
Gene symbol-
Locus tagCpin_4866
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]6086430..6087581 [-]
Producthypothetical protein
NoteTssK
UniProt IDC7PN90
KEGG IDcpi:Cpin_4866
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.00088, Aligned region: 22..94
DUF876 [PF05936], Evalue: 0.00088, Aligned region: 165..217
Protein Sequence: 383 a.a.     [Download]
>gi|256423848|ref|YP_003124501.1| hypothetical protein Cpin_4866 [Chitinophaga pinensis DSM 2588]
MIVPLKYKPVNWVDGMKLSSTHFVDTDQHHQDIVRDARSLVLTSYNYGILPPFAGQRSAYDIEIMEKATN
HVEISVRVLNAITAEGNRIDIDGAGSLQHQLHYGHYFQENSEGRTISYNVILSVNPFERVPAGIPDPEDN
PPRYPEVAKGYTISLLPTAAIAPKAADSNSLTIGQIHVSNGRITVNNNYIPPSSTVLSHPVLIRYYEQFS
ALMNDLQLSAFTIIDKTTGKESVTPLGKNIRLVSEKMLDYLAQVFFSYRNLGYQQAPVYLAQCFSGLAHV
FFTGIRHIAAKEREEMLKYFYEWRDVTPGNFEELLARAIELIYDHQDIYASVSLIEEFLKVVTALWKKLS
TLEYIGQRRENIVVAEQQIVQQVQAKRAWTLLD
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c6087581-6086430 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGATAGTACCACTGAAATATAAGCCGGTTAACTGGGTAGATGGCATGAAGCTGTCGAGTACCCACTTTG
TAGATACTGACCAGCATCACCAGGATATTGTGCGAGATGCGCGTTCGCTGGTACTGACCAGTTATAATTA
TGGCATCCTGCCGCCCTTTGCCGGACAACGTAGTGCCTATGATATTGAGATCATGGAGAAGGCGACGAAC
CATGTGGAGATCAGTGTCAGGGTGTTGAATGCGATTACGGCAGAAGGGAACAGGATTGATATAGACGGCG
CTGGCAGCTTACAGCATCAGCTGCACTACGGCCATTATTTTCAGGAGAACAGCGAAGGCCGAACTATCTC
CTATAATGTGATCCTTTCGGTGAATCCGTTTGAGCGGGTGCCTGCCGGTATTCCTGATCCGGAGGATAAT
CCGCCACGATATCCGGAGGTGGCGAAAGGGTATACTATTTCCCTCTTGCCTACGGCGGCAATCGCTCCGA
AGGCAGCGGATAGTAACAGTCTGACGATCGGGCAGATTCATGTTTCCAATGGCCGTATCACCGTGAATAA
TAATTATATACCGCCCAGCAGTACGGTGTTGAGTCATCCGGTGCTGATACGCTATTATGAGCAGTTCAGC
GCCTTAATGAACGACCTGCAATTGTCTGCCTTTACCATCATTGATAAAACAACAGGGAAAGAGTCTGTTA
CACCGCTGGGGAAGAATATCCGGCTGGTGTCAGAGAAGATGCTGGATTACCTGGCACAGGTATTCTTTAG
CTATCGCAATCTGGGCTATCAACAGGCGCCTGTTTACCTGGCGCAATGTTTCTCCGGACTGGCACATGTG
TTTTTTACCGGTATCCGGCATATTGCTGCAAAGGAAAGAGAAGAGATGCTGAAGTATTTCTATGAATGGA
GGGATGTGACACCTGGCAATTTCGAAGAACTGCTGGCCCGTGCAATAGAGCTGATATACGATCACCAGGA
TATTTATGCCAGCGTGTCATTGATAGAAGAGTTCCTGAAAGTAGTGACCGCGTTGTGGAAGAAACTGAGC
ACGCTGGAATATATCGGTCAGCGGAGGGAGAATATTGTAGTCGCCGAACAACAGATTGTACAGCAGGTGC
AGGCAAAACGTGCCTGGACATTATTGGATTGA