SecReT6
Protein ID: 256423849
SecReT6 ID913
T6SS typeiii
Gene symbol-
Locus tagCpin_4867
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]6087597..6088490 [-]
Producthypothetical protein
NoteTssN
UniProt IDC7PN91
KEGG IDcpi:Cpin_4867
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 297 a.a.     [Download]
>gi|256423849|ref|YP_003124502.1| hypothetical protein Cpin_4867 [Chitinophaga pinensis DSM 2588]
MDVQQFFMRYLLLPLIAVVSATILVVVNKKNKFINNKKLITAILVMGLVLAIPGLLGLLGLDYMPWGYIL
SMLYFIGTGCVFVYLMTRYYVNELHDRRPILVIALLIACLLGFYLYRTIFDFLSKEQIGSWAATSTFSFM
LPVLFWWSYIALLNIPAEIYKVWQYPLLPVSLDMEHLDFNRMLVLELEVFKHTRDAEPIKVKVKAPENML
FGNWFYKFIDDYNLKFPKQPVSYLATAEEPYKWIFFIRTSVFKRNVFIDPDLDIRQNGITEKVTIHAKRV
TENIARPVVTGDESIFI
 
Nucleotide Sequence: 894 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c6088490-6087597 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGGACGTACAACAATTTTTTATGCGATACCTGCTTTTGCCGCTCATAGCGGTAGTATCGGCAACAATAC
TCGTTGTTGTTAATAAGAAGAACAAATTTATTAATAACAAAAAGCTGATCACCGCCATCCTGGTGATGGG
ACTGGTGTTAGCTATACCCGGGTTACTTGGCTTACTGGGGCTGGATTATATGCCCTGGGGCTACATACTT
AGTATGCTTTATTTTATAGGGACCGGCTGCGTGTTTGTTTACCTGATGACAAGATACTATGTCAATGAAT
TACATGACCGGCGTCCCATTCTCGTAATCGCATTACTGATAGCCTGTCTGCTGGGATTTTACCTGTACCG
GACCATCTTTGATTTTTTAAGTAAAGAGCAAATAGGCAGCTGGGCCGCTACCAGCACATTCAGTTTTATG
TTACCCGTTTTGTTCTGGTGGAGTTATATCGCCTTGCTGAATATCCCCGCAGAGATCTACAAGGTATGGC
AGTATCCTTTGCTGCCGGTCAGCCTGGATATGGAACACCTGGACTTTAACAGGATGCTTGTACTTGAACT
GGAAGTATTCAAACATACCCGTGATGCGGAACCGATTAAAGTGAAGGTGAAAGCGCCGGAGAATATGCTT
TTTGGTAATTGGTTCTATAAGTTTATTGATGACTATAATCTGAAGTTTCCCAAACAGCCGGTGAGTTATC
TGGCTACGGCGGAGGAACCTTATAAATGGATCTTCTTTATCAGAACATCCGTATTCAAACGAAACGTCTT
CATTGACCCTGACCTGGATATCAGGCAGAATGGTATTACGGAGAAGGTGACCATTCATGCTAAACGGGTG
ACAGAGAATATCGCCCGGCCGGTTGTAACAGGCGATGAATCCATTTTTATCTGA