SecReT6
Protein ID: 256423850
SecReT6 ID913
T6SS typeiii
Gene symbol-
Locus tagCpin_4868
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]6088517..6089458 [-]
Producthypothetical protein
NoteTssG
UniProt IDC7PN92
KEGG IDcpi:Cpin_4868
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.90E-15, Aligned region: 168..311
Protein Sequence: 313 a.a.     [Download]
>gi|256423850|ref|YP_003124503.1| hypothetical protein Cpin_4868 [Chitinophaga pinensis DSM 2588]
MKEGLHIINELDTDFKATVKVAELLENGIVDTDQVAVLPLGPQRSAYAKDIQGYQTSYSDSLLKDRLIVE
INREGLYDMLPEGLFHVAPVRSSGLSEVEMMADVQLRRNEEKDARKFFMPFEAELNHMRILLEWYENRLD
KKTAYHDLSMVFGAEWEEFSMLDNDQRIIWMHLLPAIQQRRNDTAFMGNLLSVLFDIPVSVSVNPAAVIQ
MAVADDMRCKVGNGASLGADMVIGNSFVSEGEEMKISIGPATSEKLLAFLPGKRYAKLIDTVTAYLVPIE
TTVHVELITSEADRKGSLGNDSANTFLGFTVYL
 
Nucleotide Sequence: 942 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c6089458-6088517 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGAAAGAAGGACTGCATATCATCAATGAACTGGATACGGATTTTAAGGCGACCGTTAAAGTAGCTGAAT
TGCTGGAAAACGGGATTGTCGACACTGACCAGGTAGCAGTGCTGCCGCTTGGTCCGCAACGAAGCGCGTA
TGCGAAAGACATCCAGGGCTACCAGACAAGCTATTCGGATAGTCTGTTGAAAGACAGACTGATTGTAGAG
ATCAACCGGGAAGGCTTGTATGATATGTTGCCTGAAGGATTGTTCCACGTAGCGCCGGTGAGAAGTTCCG
GTTTGTCAGAAGTGGAAATGATGGCGGATGTACAATTGCGCAGGAATGAGGAGAAGGATGCAAGAAAGTT
CTTTATGCCTTTTGAAGCGGAGCTGAATCACATGCGTATCCTGCTGGAATGGTATGAGAACCGTCTGGAT
AAGAAGACCGCCTACCATGATCTCTCCATGGTATTTGGTGCGGAGTGGGAAGAGTTCAGTATGCTGGATA
ATGACCAGCGTATCATCTGGATGCACCTCTTACCTGCTATACAGCAACGCCGGAATGATACCGCATTTAT
GGGCAATCTTTTGTCTGTATTGTTTGATATCCCGGTGAGCGTAAGTGTTAATCCTGCTGCCGTTATACAG
ATGGCTGTAGCGGATGATATGCGCTGTAAAGTAGGCAATGGCGCGTCTCTGGGTGCTGACATGGTGATCG
GGAACAGCTTTGTCAGTGAAGGAGAAGAAATGAAGATCAGCATCGGACCTGCTACGAGTGAGAAGTTGCT
GGCTTTTCTGCCAGGCAAACGGTATGCAAAACTGATTGATACGGTAACTGCTTACCTGGTACCGATAGAA
ACAACCGTGCATGTAGAATTGATCACAAGTGAGGCTGACCGGAAAGGATCATTGGGGAATGACAGCGCCA
ATACCTTCCTGGGATTTACAGTATACCTGTAG