SecReT6
Protein ID: 256423852
SecReT6 ID913
T6SS typeiii
Gene symbol-
Locus tagCpin_4870
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]6091335..6091769 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDC7PN94
KEGG IDcpi:Cpin_4870
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-13, Aligned region: 27..127
Protein Sequence: 144 a.a.     [Download]
>gi|256423852|ref|YP_003124505.1| GPW/gp25 family protein [Chitinophaga pinensis DSM 2588]
MSDLLYQKPFRLRNIFAGKELDITDTGRSISQHIELIIFTRYGEHRHNEDYGCEIWDLDFELVVSERIWE
EKFRQSLQRSIMRDEPRLDRIEVEVKMSEVEKLFFGRNISEIKKKVALTVTGIVQSTGEHYSFNTALFLS
PLCS
 
Nucleotide Sequence: 435 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c6091769-6091335 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGTCAGACTTACTATATCAGAAACCTTTTCGTCTCAGGAACATTTTCGCAGGAAAGGAACTTGACATCA
CCGATACCGGCCGCTCTATTTCACAGCATATTGAACTGATCATCTTTACCAGATACGGAGAGCATCGTCA
TAATGAAGACTATGGTTGTGAGATCTGGGACCTGGATTTTGAACTGGTAGTCAGTGAAAGGATATGGGAA
GAGAAGTTTCGTCAGTCCCTGCAACGTTCTATTATGCGGGATGAACCAAGACTGGATCGCATAGAGGTAG
AGGTGAAAATGAGTGAAGTAGAGAAACTGTTTTTCGGCAGGAATATCTCTGAGATAAAGAAGAAAGTAGC
GCTTACCGTTACCGGTATCGTGCAGTCAACAGGCGAGCATTACAGTTTTAATACGGCGCTGTTTTTAAGT
CCGCTATGCAGTTAG