SecReT6
Protein ID: 256423853
SecReT6 ID913
T6SS typeiii
Gene symbol-
Locus tagCpin_4871
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]6091845..6092237 [-]
Producthypothetical protein
NoteHcp
UniProt IDC7PN95
KEGG IDcpi:Cpin_4871
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 0.0053, Aligned region: 13..119
Protein Sequence: 130 a.a.     [Download]
>gi|256423853|ref|YP_003124506.1| hypothetical protein Cpin_4871 [Chitinophaga pinensis DSM 2588]
MAFKATLTFSGKQYDVLQCSYSMYRDVDLKGRPTSGVYGGKIDVEVESNQDTSIIESMVNNQFKPVNGSI
TIKKQDEDAKMKEITFSDAYIVSFSEGMNAYSDSPMTVSFQISARQIKMGNADHENDWPK
 
Nucleotide Sequence: 393 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c6092237-6091845 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGGCCTTCAAAGCAACCTTAACCTTCTCTGGTAAACAATATGATGTATTGCAGTGCTCTTATTCCATGT
ATCGCGATGTGGATCTGAAAGGCAGACCTACTTCCGGTGTATACGGTGGTAAGATCGATGTAGAAGTAGA
ATCCAACCAGGATACTTCCATCATTGAAAGTATGGTAAATAACCAGTTTAAGCCGGTGAACGGCAGCATC
ACCATCAAGAAACAGGATGAAGATGCCAAGATGAAAGAGATCACCTTTTCAGATGCATATATCGTCAGCT
TCTCTGAGGGCATGAATGCCTACAGTGATAGTCCGATGACTGTCAGCTTCCAGATCTCTGCCCGTCAGAT
CAAAATGGGTAACGCAGATCACGAAAACGACTGGCCTAAGTAG