SecReT6
Protein ID: 256423854
SecReT6 ID913
T6SS typeiii
Gene symbol-
Locus tagCpin_4872
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]6092280..6093650 [-]
Producthypothetical protein
NoteTssC
UniProt IDC7PN96
KEGG IDcpi:Cpin_4872
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.30E-19, Aligned region: 120..256
DUF877 [PF05943], Evalue: 9.30E-19, Aligned region: 286..436
Protein Sequence: 456 a.a.     [Download]
>gi|256423854|ref|YP_003124507.1| hypothetical protein Cpin_4872 [Chitinophaga pinensis DSM 2588]
MASTEKQQAAGVQTAERAVKAELSLAESLEKLARVGGIDLLETAIDGLQNLNPDRKARKQIFLTGNEKRR
EREELKKKIRLWIDILENADSVATMIERSNERLQVAEENINKNIGIALKATRELEQSYRAVNLFYQNTEA
DKLKNVVLLNASQEQIQDLDNPRFIEYVNDELKQKYDRLDLRENYSLLVVPGYMGSNKVVEKWAAIAYKH
KAMLITDFADLDHPDDVIDLFTEANLTGGDAYRSNVIMTCNWLIGRGKVQEVGENDDLTVPGSAALAGKM
YHTLMSQVTAGKKHGSMNDVDGVRFELKKSEISHLERLGLVPMVNEYGKVMAFSAKTLFNGDNIGLQTYS
VVRVFDYITKVLFDFLNRRAFENWTSKTEKDLRGQIVKFLDRIQGPDRLIEHFKIMRFERDEVQKDTIHL
DIHITPYFPAKSFVVKLDGYKGEDEATTWASEYAQQ
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c6093650-6092280 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGGCAAGTACTGAAAAACAACAGGCAGCCGGTGTTCAAACCGCAGAGAGAGCAGTAAAGGCGGAGCTGT
CCCTGGCAGAAAGTCTGGAGAAACTGGCCCGTGTGGGTGGTATCGATCTGCTGGAAACAGCAATAGATGG
TTTACAAAACCTGAACCCCGACAGAAAGGCCAGGAAACAGATCTTTCTGACCGGCAATGAGAAACGGAGG
GAACGTGAAGAACTGAAAAAAAAGATCCGTCTCTGGATAGACATTCTGGAGAATGCAGACTCCGTAGCTA
CTATGATAGAACGTAGTAATGAGCGCTTACAGGTGGCAGAAGAGAATATCAATAAAAACATCGGCATCGC
ACTGAAAGCGACCCGTGAACTGGAACAATCCTATCGCGCAGTTAACCTGTTCTACCAGAACACAGAAGCA
GATAAGCTCAAGAATGTCGTACTGCTGAATGCTTCCCAGGAGCAGATACAGGACCTCGATAATCCACGCT
TCATCGAGTATGTAAATGATGAACTGAAACAGAAATATGACCGTCTGGATCTGCGGGAGAACTATTCCCT
GCTGGTAGTGCCGGGTTATATGGGTTCCAACAAAGTGGTAGAGAAATGGGCGGCTATTGCCTATAAACAT
AAGGCGATGCTGATCACGGACTTTGCTGACCTGGATCATCCGGATGATGTGATCGACCTCTTTACAGAAG
CTAATCTCACCGGCGGAGACGCATATAGATCAAATGTGATTATGACCTGCAACTGGCTGATCGGCCGTGG
TAAAGTGCAGGAAGTCGGTGAAAACGACGACCTGACTGTGCCCGGTTCGGCAGCACTGGCCGGAAAGATG
TATCATACGCTTATGTCGCAGGTGACGGCAGGTAAGAAACATGGTTCTATGAATGATGTGGATGGCGTGC
GCTTCGAACTGAAGAAAAGTGAGATCTCTCACCTGGAAAGACTCGGTCTGGTACCCATGGTAAATGAGTA
TGGTAAAGTAATGGCCTTCTCTGCCAAAACGCTTTTCAACGGCGATAATATTGGTTTACAGACCTATTCA
GTAGTAAGGGTATTTGACTACATCACCAAGGTGCTTTTTGATTTCCTCAACAGACGTGCTTTTGAAAACT
GGACCTCCAAAACGGAAAAGGACCTGCGTGGACAGATCGTTAAATTCCTGGACAGGATACAGGGACCAGA
CCGCCTGATCGAGCATTTCAAGATCATGCGCTTCGAGCGGGATGAAGTACAGAAAGATACCATCCACCTG
GATATCCATATCACGCCTTATTTCCCGGCAAAGAGTTTTGTGGTAAAACTCGATGGCTACAAAGGGGAAG
ACGAAGCGACCACCTGGGCATCAGAATATGCACAACAATAA