SecReT6
Protein ID: 256423855
SecReT6 ID913
T6SS typeiii
Gene symbol-
Locus tagCpin_4873
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]6093681..6094127 [-]
Producthypothetical protein
NoteTssB
UniProt IDC7PN97
KEGG IDcpi:Cpin_4873
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 148 a.a.     [Download]
>gi|256423855|ref|YP_003124508.1| hypothetical protein Cpin_4873 [Chitinophaga pinensis DSM 2588]
MFNYEIGGNERKIDTSEAFADIAYNKTLFVQKLTDNDPIRPEKVEGLKTVQEVFNHYKPNVNVEFERYDG
SFANENLQFNNLGDFSIRSIVGQSQHLNNVSIEKEMSMSVIKQLKSNKTLKTTLDNEETKNAFISALRNF
ITELEENK
 
Nucleotide Sequence: 447 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c6094127-6093681 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGTTTAACTACGAAATAGGCGGCAACGAAAGAAAGATCGATACCTCGGAGGCATTTGCTGACATTGCCT
ACAATAAGACACTCTTTGTACAGAAACTGACGGACAATGATCCGATCAGACCGGAAAAAGTGGAAGGGCT
GAAAACGGTACAGGAAGTGTTCAATCACTACAAACCAAATGTGAATGTGGAGTTTGAACGCTACGACGGT
TCCTTCGCTAATGAGAATCTGCAATTCAATAACCTGGGCGATTTCTCTATCAGGAGTATCGTCGGACAAA
GTCAGCATCTCAACAACGTGAGTATTGAAAAGGAAATGTCTATGAGCGTGATCAAACAACTGAAGTCGAA
TAAGACTTTAAAGACAACGCTGGACAATGAAGAGACAAAGAACGCATTTATCAGTGCACTCAGGAATTTC
ATCACCGAACTGGAAGAAAATAAATAA