SecReT6
Protein ID: 256423858
SecReT6 ID913
T6SS typeiii
Gene symbol-
Locus tagCpin_4876
StrainChitinophaga pinensis DSM 2588
Repliconchromosome [GenBank: NC_013132] [Browse all T6SS(s) in this replicon]
Location [Strand]6098982..6099923 [-]
ProductPKD domain-containing protein
NoteTssP
UniProt IDC7PNA0
KEGG IDcpi:Cpin_4876
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 7.00E-15, Aligned region: 74..105
PKD [PF00801], Evalue: 7.00E-15, Aligned region: 135..186
HPIH [PF13323], Evalue: 0.0028, Aligned region: 17..108
Protein Sequence: 313 a.a.     [Download]
>gi|256423858|ref|YP_003124511.1| PKD domain-containing protein [Chitinophaga pinensis DSM 2588]
MFDPIIDDAKSVNSNSRRSIFIYVIIVILALTAFIFLFKNVFADKRTSDASILKNELYMNEELVYADNTS
GAKNWRWEFGDGTSSNTQSGTYHYGKAGSYIVRLTIDGDMKVQFPVTVKDTVIAQTDTTLIINGPTSGVV
NEEVRLEAEGKGTQFEWSFGETGRVDVNGRTALYTFRKPGTYMVRLISDKSHPVTHIMYITDPSLDTVLV
VPGEGERKIIDDIRARLQAIADGEDFNSNYYYLINKYLCGNEKITVAIEQDSNKKSSDFYTYCMGLTFGG
EISVDQAQLTISPKASCATLLNIKQHSARTANK
 
Nucleotide Sequence: 942 bp     [Download]
>gi|256419057|ref|NC_013132.1|:c6099923-6098982 Chitinophaga pinensis DSM 2588 chromosome, complete genome
ATGTTCGACCCAATCATCGACGATGCAAAGTCAGTGAACAGTAACTCGAGACGATCCATCTTTATCTATG
TCATTATTGTTATCCTGGCGCTGACAGCATTCATCTTTCTGTTTAAGAACGTCTTTGCAGATAAACGCAC
GAGTGACGCCAGCATCCTGAAAAATGAGCTGTATATGAACGAAGAACTGGTCTATGCGGATAATACCAGC
GGCGCAAAAAACTGGCGCTGGGAATTCGGGGACGGTACCAGTTCAAATACACAGAGTGGTACTTATCACT
ACGGAAAGGCAGGCTCTTATATCGTGCGTCTCACCATAGATGGGGATATGAAGGTACAGTTTCCCGTAAC
AGTGAAAGATACCGTGATCGCACAGACAGATACGACACTCATCATCAACGGACCCACTTCCGGCGTAGTC
AATGAAGAAGTACGTCTGGAAGCAGAAGGGAAAGGAACACAGTTTGAATGGTCTTTCGGAGAGACGGGAA
GGGTAGATGTAAACGGCCGTACTGCGCTGTATACCTTCCGGAAACCGGGTACCTATATGGTAAGACTGAT
CAGTGATAAGAGTCATCCTGTCACCCATATCATGTATATCACTGATCCGAGTTTAGATACGGTACTGGTG
GTGCCCGGAGAAGGGGAGCGCAAGATCATTGACGATATTCGTGCACGTCTGCAGGCCATTGCTGATGGAG
AAGACTTTAACAGTAATTACTACTACCTCATCAATAAATATCTGTGCGGCAATGAAAAGATCACAGTTGC
TATTGAACAGGATAGCAACAAAAAAAGCAGTGACTTCTATACTTACTGTATGGGACTCACATTCGGTGGA
GAAATTTCTGTCGATCAGGCACAGTTAACCATTAGTCCGAAAGCATCCTGCGCCACATTGTTAAACATTA
AACAACACTCCGCCCGCACAGCGAATAAATAA