SecReT6
Protein ID: 256823708
SecReT6 ID361
T6SS typei5
Gene symbol-
Locus tagKkor_2494
StrainKangiella koreensis DSM 16069
Repliconchromosome [GenBank: NC_013166] [Browse all T6SS(s) in this replicon]
Location [Strand]2696217..2697707 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDC7R9B3
KEGG IDkko:Kkor_2494
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.30E-187, Aligned region: 63..493
Protein Sequence: 496 a.a.     [Download]
>gi|256823708|ref|YP_003147671.1| unnamed protein product [Kangiella koreensis DSM 16069]
MTEMEKVAAKEQLVEQSPDILSQAIAATKQTEATRAEELLRALTSEAMKGTVTWNKNLTVTFKEAIDKID
EALSDQLSKIMHNERFQKLEGSWRGLQYLVQNTDTSVSMKLKVINLPKRELFKDLSKAVEFDQSQLFKKI
YESEFGTAGGEPFGALIGDYEFTNHPEDIETLELTSNVAAGAFAPFISASSPELFGFNDWTELSKPRDLE
KIFDSLEYARWRGFRDSEDSRFVTLTAPRVLARLPYGEQTRPIEEFAFEELPVDSNTKVANSVDNKDYCW
MNASYVLGSKLTQAFTEHGWCTAIRGAEGGGKVTSLPMHNFLSDDGDMDMQCPTEVGITDRREAELSKLG
FLPLCHYKNTDYAVFFGSNTTQRPKRYDSPDATANADISSRLPYIMATSRFAHYLKVLARDKIGSFMEPE
DCESWLNRWILNYVNADEAAGQESRAKYPLAEARVEVEEVPGSPGVYHAKAWLKPWLQLEELSTSLRLVA
KIPESK
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|256821228|ref|NC_013166.1|:c2697707-2696217 Kangiella koreensis DSM 16069 chromosome, complete genome
ATGACAGAAATGGAAAAAGTTGCCGCAAAGGAGCAGCTCGTTGAGCAAAGCCCAGATATATTAAGCCAGG
CCATTGCGGCGACTAAGCAAACTGAAGCGACTCGCGCGGAAGAGTTGCTGAGAGCGCTAACTTCAGAAGC
GATGAAGGGAACTGTCACCTGGAATAAAAACCTGACCGTTACGTTCAAAGAAGCCATCGACAAAATTGAC
GAGGCTCTATCCGACCAGTTATCTAAAATTATGCACAATGAGCGTTTTCAGAAGCTGGAAGGTTCATGGC
GTGGTTTGCAGTATCTGGTACAAAACACTGATACCTCGGTTTCCATGAAACTTAAGGTGATCAACTTACC
GAAACGTGAATTATTTAAAGATTTAAGCAAAGCAGTAGAGTTTGACCAAAGCCAGCTGTTTAAGAAAATC
TATGAGAGTGAATTCGGTACTGCTGGTGGTGAGCCTTTCGGTGCTTTGATTGGTGACTACGAGTTTACCA
ATCATCCAGAAGATATTGAAACATTAGAACTGACTTCGAATGTTGCCGCCGGAGCCTTCGCGCCCTTCAT
TTCAGCATCATCTCCGGAACTGTTTGGATTCAATGATTGGACAGAGTTATCAAAACCACGTGATTTGGAA
AAGATCTTTGATTCATTAGAATACGCCCGCTGGCGTGGTTTCAGAGACTCGGAAGATTCTCGCTTTGTAA
CACTGACGGCACCTCGCGTGTTGGCTCGTTTGCCATACGGTGAGCAAACCCGTCCGATAGAAGAGTTTGC
ATTTGAAGAACTGCCAGTCGACAGCAACACTAAAGTGGCTAACAGTGTTGATAATAAAGATTATTGCTGG
ATGAATGCATCATATGTGCTGGGCAGTAAACTAACCCAGGCCTTTACTGAACACGGCTGGTGTACTGCAA
TTCGTGGTGCTGAAGGTGGTGGTAAAGTGACTTCATTGCCAATGCACAACTTCCTCAGTGATGATGGTGA
TATGGATATGCAGTGTCCAACTGAAGTAGGCATTACCGATCGTCGTGAAGCTGAGTTAAGCAAGCTTGGC
TTCTTACCCTTGTGTCATTATAAAAACACCGACTATGCAGTGTTCTTCGGTTCAAACACCACGCAGCGTC
CAAAGCGCTATGACAGTCCTGATGCAACCGCTAATGCCGATATTTCATCGCGTTTGCCTTATATCATGGC
CACGTCGCGGTTTGCGCACTACCTGAAAGTCCTGGCGCGCGATAAGATTGGCTCTTTCATGGAGCCGGAA
GATTGCGAATCATGGTTAAATCGCTGGATTCTAAACTACGTCAATGCTGATGAGGCCGCTGGTCAAGAGT
CTCGTGCCAAGTATCCACTGGCCGAAGCTCGAGTTGAAGTTGAAGAGGTGCCAGGTAGTCCGGGAGTCTA
TCACGCGAAAGCCTGGTTGAAGCCATGGTTACAACTGGAAGAACTCAGCACCTCATTACGTTTAGTGGCG
AAGATTCCAGAAAGTAAATAA