SecReT6
Protein ID: 256823709
SecReT6 ID361
T6SS typei5
Gene symbol-
Locus tagKkor_2495
StrainKangiella koreensis DSM 16069
Repliconchromosome [GenBank: NC_013166] [Browse all T6SS(s) in this replicon]
Location [Strand]2697704..2698222 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDC7R9B4
KEGG IDkko:Kkor_2495
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-59, Aligned region: 8..162
Protein Sequence: 172 a.a.     [Download]
>gi|256823709|ref|YP_003147672.1| unnamed protein product [Kangiella koreensis DSM 16069]
MASIHDRLKKVRKPRVHITYDVETDGAVLEKELPFVVGVMGDFSADSTKPVKPLKERRFIQIDKDNINEV
MKNMSPGLNIKVDNTLENDGSEMAVNLKFDSMEDFEPAAIVDQVEPLKKLMDTRNKLRDLMTKIDRSEEL
EGLMEKVLQNSDDLNALAEALGQIDEKTGDEQ
 
Nucleotide Sequence: 519 bp     [Download]
>gi|256821228|ref|NC_013166.1|:c2698222-2697704 Kangiella koreensis DSM 16069 chromosome, complete genome
ATGGCGAGTATACATGATCGTTTGAAAAAAGTGCGTAAGCCAAGAGTCCACATTACCTATGATGTGGAAA
CCGATGGCGCAGTATTGGAAAAGGAGCTGCCTTTTGTAGTTGGTGTCATGGGCGATTTTAGTGCCGACTC
TACAAAACCAGTGAAGCCATTAAAGGAGCGACGCTTCATTCAAATTGATAAAGACAATATCAATGAAGTG
ATGAAAAATATGTCGCCGGGACTCAATATTAAAGTCGACAATACTTTAGAAAATGATGGTTCGGAAATGG
CGGTTAACTTGAAGTTCGATTCGATGGAAGACTTTGAGCCAGCAGCTATCGTTGATCAAGTTGAACCATT
AAAGAAGTTAATGGACACGCGTAATAAGTTACGTGATTTGATGACTAAGATTGACCGTTCTGAAGAGTTG
GAAGGGTTAATGGAAAAAGTCTTACAAAATAGTGATGACTTGAATGCGCTAGCAGAGGCTCTTGGACAAA
TCGATGAAAAGACAGGAGATGAGCAATGA