SecReT6
Protein ID: 256823710
SecReT6 ID361
T6SS typei5
Gene symbol-
Locus tagKkor_2496
StrainKangiella koreensis DSM 16069
Repliconchromosome [GenBank: NC_013166] [Browse all T6SS(s) in this replicon]
Location [Strand]2698253..2699329 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDC7R9B5
KEGG IDkko:Kkor_2496
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-17, Aligned region: 60..115
Protein Sequence: 358 a.a.     [Download]
>gi|256823710|ref|YP_003147673.1| unnamed protein product [Kangiella koreensis DSM 16069]
MYIENYIKPISEDNPCGRDLREDTSVESIYYKLRDARNSARKTERLALADAEDAGAVDDNWFQLKELALQ
ALEHETKDLEVVAWLIEALTRIDGIKGLSFGYRIANELISSFWDKGIYPAIDEDGIETRVAPLSGLNGFD
GAGTLITPIKSVAITDSEEYLPVCVWQYEQAVQLERLDAEKKQNRIDNGAIPLESIKKAVLLTEPSFYRE
LVADVQSALETYETFTNEFDRVCDSLPQPTSNIRNALKECIEAVEYLARDKLASSDELVSQDSKEGVTDS
PGAEVRAINRREQAVNTLRQVAQYFRETEPHSPISYLLEQSIRWSDLSLPELLQQLIPEEGAREQYFKLT
GIDAGSNQ
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|256821228|ref|NC_013166.1|:c2699329-2698253 Kangiella koreensis DSM 16069 chromosome, complete genome
ATGTATATTGAAAACTATATCAAACCGATTAGTGAAGACAATCCTTGTGGGCGAGACTTACGAGAAGACA
CCAGTGTTGAATCGATATATTACAAGTTAAGAGACGCCCGAAATTCAGCAAGAAAAACTGAGCGTTTGGC
ATTAGCTGATGCCGAGGATGCAGGGGCCGTTGATGACAACTGGTTTCAGCTAAAAGAGCTGGCATTACAG
GCTTTAGAGCATGAGACAAAGGATCTAGAAGTAGTTGCCTGGTTGATTGAAGCTTTGACCAGAATTGATG
GCATCAAGGGGTTAAGTTTTGGCTATAGGATAGCCAATGAATTGATTTCCAGTTTCTGGGACAAAGGAAT
TTATCCAGCAATTGATGAAGATGGTATTGAAACTCGGGTAGCACCTCTATCAGGACTTAACGGGTTTGAT
GGTGCCGGCACACTGATTACCCCAATTAAATCGGTAGCGATTACCGATAGTGAAGAGTATTTGCCGGTTT
GTGTTTGGCAGTATGAACAGGCCGTGCAGCTGGAACGATTAGACGCTGAGAAAAAACAAAACCGAATTGA
TAATGGCGCAATACCATTAGAAAGTATTAAGAAAGCGGTGCTGTTGACTGAGCCGAGCTTCTATAGAGAG
CTTGTTGCCGACGTGCAATCTGCTTTAGAAACCTACGAAACCTTTACCAATGAATTTGATCGAGTGTGTG
ATTCATTGCCGCAACCAACCTCTAATATCAGGAATGCACTGAAAGAGTGTATTGAGGCTGTTGAGTATCT
GGCAAGAGACAAATTAGCGTCGTCAGATGAATTGGTCAGTCAGGATAGTAAAGAAGGAGTTACTGATAGC
CCTGGTGCGGAAGTGCGAGCTATTAACCGACGCGAGCAGGCGGTTAATACACTGAGACAGGTAGCACAGT
ATTTTCGAGAAACTGAACCTCACTCACCTATTTCATATCTGCTGGAGCAAAGTATTCGTTGGAGTGATTT
GTCATTACCAGAATTGTTGCAGCAATTGATTCCAGAAGAAGGTGCGCGTGAACAGTATTTTAAACTAACA
GGGATCGATGCGGGTAGTAACCAATAA