SecReT6
Protein ID: 256823714
SecReT6 ID361
T6SS typei5
Gene symbol-
Locus tagKkor_2500
StrainKangiella koreensis DSM 16069
Repliconchromosome [GenBank: NC_013166] [Browse all T6SS(s) in this replicon]
Location [Strand]2704496..2705815 [-]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDC7R9P0
KEGG IDkko:Kkor_2500
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.70E-62, Aligned region: 47..252
OmpA [PF00691], Evalue: 1.20E-15, Aligned region: 319..416
Protein Sequence: 439 a.a.     [Download]
>gi|256823714|ref|YP_003147677.1| unnamed protein product [Kangiella koreensis DSM 16069]
MRDMDRTILVPRPGGVQRPLDANEQTLEPDLSRSQKIPLSAFKIGVNPIIDAATTLLSLAIELKQATQIN
NINMLHKQCMNHIKEFEQQLRQDEISSETIAEARYAICSLIDEIVLNSPWGANSIWSTKSLLSVFYKQTW
GGEQFYKIIHERVKVALNNQYLLELMYLCLQLGFKGKYQVEDNGFERLEMEKEQLYAVLKKLQPEQEKDL
SPRWRSNVTDLIEKQRAVPLWAVGILTVTILLGLYMSFSYQLSQKAEPVYNSIASLVPENKVDLASSDSV
INYAKNLRQLLSTEIGRGLLQVVEDIDHVAIIITSNQMYSSASAQLNENSIALIEKIGQIATTTPGHIQV
VGHSDDQKIFTAKYHSNWELSLARANSVVRILNQNQNLAGRVTAEGRGAAEPRVANDTDTNRALNRRVEI
LLWVKDKFKDKQTVEVSEL
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|256821228|ref|NC_013166.1|:c2705815-2704496 Kangiella koreensis DSM 16069 chromosome, complete genome
ATGAGGGATATGGATAGAACAATACTGGTACCAAGGCCGGGAGGAGTACAGCGCCCGCTGGATGCTAATG
AGCAGACGTTGGAGCCAGATCTAAGCAGAAGTCAGAAAATACCGTTAAGCGCATTTAAGATTGGGGTGAA
CCCGATCATTGATGCTGCCACTACCTTATTGAGTCTTGCTATTGAGCTAAAGCAGGCGACTCAAATCAAT
AATATCAATATGCTGCACAAGCAGTGCATGAATCATATCAAAGAATTTGAGCAGCAACTGAGACAGGATG
AAATCAGTTCAGAGACGATTGCTGAAGCCAGATATGCTATTTGCTCATTGATTGATGAGATTGTTCTTAA
TTCACCCTGGGGTGCAAATAGTATCTGGAGTACAAAAAGTTTATTAAGTGTTTTTTATAAGCAAACCTGG
GGTGGGGAACAGTTTTATAAAATTATCCATGAAAGAGTCAAAGTGGCGCTCAATAATCAATATCTATTAG
AGCTGATGTATTTGTGTCTACAGCTTGGCTTTAAAGGTAAATACCAAGTTGAGGATAATGGTTTTGAGCG
GTTGGAGATGGAAAAAGAGCAGCTCTATGCCGTGTTAAAAAAACTTCAGCCTGAGCAAGAAAAAGATCTA
TCACCCCGTTGGCGCAGCAATGTTACAGACTTAATAGAAAAGCAAAGAGCAGTTCCTTTGTGGGCGGTTG
GTATCTTAACCGTAACTATTCTTCTTGGATTATATATGTCTTTTAGTTATCAGCTCAGTCAAAAAGCAGA
ACCAGTCTATAACAGCATCGCTTCTTTAGTGCCAGAAAACAAAGTAGATCTGGCTAGTAGTGATTCAGTG
ATTAATTATGCGAAAAACTTACGACAATTATTAAGCACAGAAATTGGGCGTGGATTATTGCAAGTGGTTG
AAGATATCGACCACGTAGCAATCATTATAACCAGCAATCAAATGTACTCATCAGCGAGTGCTCAGCTCAA
TGAGAATAGCATCGCACTGATTGAAAAAATTGGACAGATCGCGACTACTACTCCGGGTCACATTCAAGTG
GTTGGGCATAGTGATGACCAGAAAATATTTACCGCAAAATATCATTCCAACTGGGAGCTTTCGTTAGCCA
GAGCTAATTCAGTAGTGAGGATATTAAACCAGAATCAAAATTTGGCCGGACGAGTGACAGCAGAAGGTCG
TGGGGCGGCGGAGCCAAGAGTAGCCAATGATACTGATACCAATCGAGCATTAAACAGGCGGGTTGAAATT
CTTTTGTGGGTAAAAGACAAGTTTAAGGATAAACAAACAGTGGAAGTAAGTGAGCTATAG