SecReT6
Protein ID: 256823715
SecReT6 ID361
T6SS typei5
Gene symbol-
Locus tagKkor_2501
StrainKangiella koreensis DSM 16069
Repliconchromosome [GenBank: NC_013166] [Browse all T6SS(s) in this replicon]
Location [Strand]2705850..2707193 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDC7R9P1
KEGG IDkko:Kkor_2501
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.60E-124, Aligned region: 17..443
Protein Sequence: 447 a.a.     [Download]
>gi|256823715|ref|YP_003147678.1| unnamed protein product [Kangiella koreensis DSM 16069]
MSNKVVWSQGLFLTPEHFQQQDQYNEYQLKRMIKSLSRHGYGLKKLILNKEQLLQGKLGVKEAEGLLKDG
TYFSIPERNLLPSLLDLSEVDNINDKRIMLAIAENVDNKKLVAQEINSESSKRYRKELKKVSSINVGEES
EIAIEVAEENYQLMVEGKSQDGYECLPIARIKEKKQDGSIELDESFVPVVLDLHASGILSSRMNNLLSLL
EHRREKLAAKVMGVDNSTASSIHNYLILQLLNKYLAELQQLLEQEYSIPYELYLGLINLEAELATFYSSA
RKPQKQMAYSQNMIDECFSQVEASIKQYLSHVLDESAHEIVLEDKGYGVRVAHIDQVELFKQASFVIAVK
AEIATRELKEQLPRQIKIGSLSNIRQLVNAQLPGINLSEMSVAPREVPVKKDYSYFAIDSRSPLWNENST
SRSIAFHISGDFPGLDVELWAIKNELS
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|256821228|ref|NC_013166.1|:c2707193-2705850 Kangiella koreensis DSM 16069 chromosome, complete genome
ATGAGCAACAAGGTGGTTTGGTCACAAGGCTTATTTTTAACCCCTGAGCACTTTCAACAACAAGACCAAT
ACAATGAATACCAGCTAAAGAGGATGATCAAGTCATTGTCCAGGCATGGCTATGGATTAAAGAAGCTGAT
ACTCAATAAAGAGCAACTGTTACAAGGCAAGCTTGGCGTAAAGGAAGCCGAAGGATTGCTGAAGGACGGT
ACTTATTTTTCGATTCCTGAGAGGAACCTCTTGCCGTCACTGTTAGACCTGTCGGAAGTGGACAATATCA
ATGACAAGCGAATCATGCTGGCCATTGCCGAAAATGTCGATAATAAGAAACTGGTAGCTCAGGAAATTAA
CAGCGAATCCAGTAAGCGATATCGAAAAGAACTCAAAAAAGTTAGCAGTATCAATGTAGGTGAAGAGAGC
GAGATTGCCATTGAAGTAGCTGAAGAAAATTATCAGTTGATGGTAGAGGGTAAAAGTCAGGATGGTTATG
AATGTCTGCCAATCGCTAGAATAAAAGAGAAAAAGCAGGACGGCAGCATTGAGCTTGATGAGTCCTTCGT
ACCTGTAGTGCTGGACCTTCATGCTAGCGGTATTCTCAGCAGCAGAATGAATAATTTATTGAGTCTGCTT
GAACACCGTAGAGAAAAATTAGCCGCAAAAGTCATGGGTGTCGATAATTCGACAGCGAGCAGCATCCATA
ACTACCTCATATTGCAATTGCTCAATAAATATTTAGCAGAGTTACAACAGTTGCTGGAGCAGGAGTATAG
CATTCCTTATGAGCTGTATTTGGGCTTGATTAATCTCGAAGCGGAGTTGGCTACCTTCTACAGCTCTGCG
CGTAAACCACAAAAGCAAATGGCCTACTCGCAAAACATGATCGATGAATGTTTCAGTCAGGTCGAGGCGA
GCATTAAGCAATACTTAAGCCATGTGTTAGATGAAAGTGCTCATGAAATAGTGTTGGAAGATAAGGGTTA
TGGCGTAAGAGTTGCTCATATTGATCAGGTAGAACTGTTTAAGCAGGCCAGTTTTGTGATTGCTGTAAAA
GCAGAAATAGCGACAAGAGAATTAAAAGAGCAATTACCCAGACAAATAAAAATTGGCAGTCTGAGCAACA
TCAGGCAATTGGTCAATGCGCAATTACCAGGGATAAACCTGTCTGAAATGTCGGTTGCGCCAAGAGAAGT
ACCGGTTAAAAAAGATTACAGTTATTTTGCTATTGATAGCCGTTCTCCGCTGTGGAATGAAAATAGTACT
TCCAGAAGTATTGCATTCCATATTTCTGGAGACTTCCCAGGTCTCGATGTTGAGTTATGGGCAATCAAAA
ATGAACTGTCCTAA