SecReT6
Protein ID: 256823716
SecReT6 ID361
T6SS typei5
Gene symbol-
Locus tagKkor_2502
StrainKangiella koreensis DSM 16069
Repliconchromosome [GenBank: NC_013166] [Browse all T6SS(s) in this replicon]
Location [Strand]2707203..2707664 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC7R9P2
KEGG IDkko:Kkor_2502
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-29, Aligned region: 18..149
Protein Sequence: 153 a.a.     [Download]
>gi|256823716|ref|YP_003147679.1| unnamed protein product [Kangiella koreensis DSM 16069]
MKVINSLQKIVLVIVVAAGLAGCGLLKSGDGEEVELRINVAEQVNPDELGRSSPIVIRLYELKKAVAIDG
LDFFSVYDQTGPEFKAAVSSMKEFQVNPGQAIVQTVLTDGSTKHLMIVAAFKDIDNSQWKVTHDLEQSDE
LTIAIEGKTIIKQ
 
Nucleotide Sequence: 462 bp     [Download]
>gi|256821228|ref|NC_013166.1|:c2707664-2707203 Kangiella koreensis DSM 16069 chromosome, complete genome
ATGAAAGTTATAAATAGTTTGCAAAAAATAGTATTAGTTATTGTTGTGGCAGCTGGGCTAGCGGGTTGTG
GTTTATTGAAAAGTGGTGACGGGGAAGAGGTAGAGTTACGTATAAATGTAGCCGAACAAGTAAATCCTGA
TGAGCTAGGGCGCTCATCCCCTATCGTTATCCGGCTGTACGAATTGAAGAAAGCAGTTGCGATAGATGGC
CTGGATTTTTTTAGTGTCTATGACCAGACAGGACCTGAGTTTAAAGCAGCTGTTTCGAGCATGAAAGAAT
TTCAGGTCAATCCTGGACAGGCGATCGTGCAAACAGTTTTAACCGATGGGTCAACAAAACATCTCATGAT
AGTGGCTGCATTTAAAGATATTGATAACAGCCAATGGAAGGTGACACATGACCTGGAACAATCTGATGAG
CTAACGATAGCCATAGAAGGTAAAACTATAATTAAGCAATAA