SecReT6
Protein ID: 256823717
SecReT6 ID361
T6SS typei5
Gene symbol-
Locus tagKkor_2503
StrainKangiella koreensis DSM 16069
Repliconchromosome [GenBank: NC_013166] [Browse all T6SS(s) in this replicon]
Location [Strand]2707673..2709073 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDC7R9P3
KEGG IDkko:Kkor_2503
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.50E-15, Aligned region: 30..98
Protein Sequence: 466 a.a.     [Download]
>gi|256823717|ref|YP_003147680.1| unnamed protein product [Kangiella koreensis DSM 16069]
MKQLTLRITSFHRLSPDQVATKTFDRVGGVIGRSADSDWVLPDPEKIVSSTHAVISFEAGSYSVTDYSTN
GLFINRSVEPVGKGQSRLLQDGDYLQIGEYEVEVEVRNHEAMDYEHAGGVQKQSSYQAEPHIESAAKNEA
IPAYHELATSQQAEYEQSQHETQVSSNPLHASYSAPAPKQSPYSSTVATDKAVEAAQQAKAQPIPEEWEQ
SLQAGIQSSQPTQHQPQQKVTQSQSVQASEPQEIPPIPAAVTQHNVVASGDNGVENSSDNSQVCLTALLK
GLGLNAEEIQLSNQPEFYHRLGAALRLSLQGMLDILRARASMKSEFRVMQTTIRTQENNPLKFSINVDEA
IRNLFARRIPGFLNWDQAIQECFKDMSSHELALMAGTEGAVNAVLDQLSPENFTVEEDNNKSLEKWIPVA
KKARHWDRYKDQYKRVNEELGQGSGKRFSEEFAEAYEAQLTALGVR
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|256821228|ref|NC_013166.1|:c2709073-2707673 Kangiella koreensis DSM 16069 chromosome, complete genome
ATGAAGCAATTAACACTTCGAATTACCAGTTTTCACCGTTTATCTCCGGATCAGGTCGCGACCAAGACCT
TTGATCGAGTGGGTGGTGTTATTGGACGCTCGGCAGACTCAGACTGGGTGCTACCTGACCCAGAAAAGAT
TGTATCGAGTACCCATGCCGTTATTAGTTTTGAAGCCGGCAGTTATTCAGTTACCGACTATTCAACCAAT
GGTTTGTTTATCAATCGTTCTGTAGAACCGGTAGGAAAAGGCCAATCTCGCCTATTGCAGGATGGAGATT
ATTTGCAGATTGGTGAGTATGAAGTCGAGGTCGAAGTCAGAAATCATGAAGCAATGGATTATGAACATGC
CGGAGGGGTGCAGAAGCAAAGTAGCTATCAGGCTGAACCACACATTGAATCAGCTGCTAAAAATGAAGCT
ATCCCTGCATACCATGAGCTGGCAACCAGCCAGCAAGCAGAATATGAACAGAGTCAGCATGAAACTCAGG
TAAGTTCGAATCCTCTTCATGCGAGTTACAGTGCACCAGCTCCTAAGCAAAGCCCTTATTCTTCTACTGT
TGCAACGGATAAAGCAGTTGAAGCTGCGCAGCAAGCCAAAGCTCAGCCAATTCCTGAGGAGTGGGAACAG
AGCCTTCAGGCCGGTATTCAGAGTAGCCAGCCAACGCAGCATCAGCCACAGCAAAAAGTAACGCAATCAC
AATCAGTACAAGCATCAGAACCACAAGAAATACCGCCAATTCCAGCAGCTGTAACTCAACACAATGTCGT
GGCTAGCGGGGATAATGGAGTCGAAAATAGTAGCGACAATTCACAAGTGTGCCTGACTGCCCTTTTGAAA
GGACTCGGTTTAAATGCCGAGGAAATCCAGCTGAGTAATCAGCCAGAGTTTTATCATCGACTGGGCGCAG
CCTTGAGGCTGTCATTGCAAGGGATGCTGGATATTTTGCGCGCTCGAGCCAGCATGAAAAGTGAGTTCAG
AGTGATGCAGACCACTATCAGGACTCAGGAAAACAATCCTTTGAAATTCTCAATCAATGTAGATGAAGCG
ATAAGAAATCTTTTTGCTCGACGTATTCCAGGATTCTTAAATTGGGATCAGGCAATACAGGAATGCTTTA
AAGATATGAGCAGTCATGAGCTGGCATTGATGGCTGGCACAGAAGGTGCGGTGAATGCCGTGTTGGATCA
GTTAAGCCCTGAGAACTTTACAGTGGAGGAAGACAATAACAAGAGTCTTGAAAAGTGGATTCCAGTGGCC
AAGAAAGCAAGGCATTGGGATCGATACAAAGACCAGTATAAGAGAGTTAACGAAGAGTTAGGCCAAGGTT
CTGGTAAGCGTTTTTCTGAAGAGTTTGCTGAAGCGTATGAAGCGCAATTGACAGCATTGGGTGTGAGATA
G