SecReT6
Protein ID: 259907291
SecReT6 ID331
T6SS typei3
Gene symbol-
Locus tagEpC_06150
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]712803..713315 [+]
Producttype VI secretion system, lipoprotein VCA0113
NoteTssJ
UniProt IDD0FP51
KEGG IDepy:EpC_06150
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.60E-30, Aligned region: 20..141
Protein Sequence: 170 a.a.     [Download]
>gi|259907291|ref|YP_002647647.1| type VI secretion system, lipoprotein VCA0113 [Erwinia pyrifoliae Ep1/96]
MHRLSISRLITQSFLLAAFTLLAGCVSSSRSVPAQYSLVFQAHPQINDSAPLKVRVLLLKSDADFMAADF
YSLQTHPQAVLGQNLLNSEQFFLMPGQTDKKRVGQSSPEARYIGIMAEYQTLDGKKWRVSLPVPLPAERH
FYQIWQGDADNLRADVIADINGVRVINARD
 
Nucleotide Sequence: 513 bp     [Download]
>gi|259906682|ref|NC_012214.1|:712803-713315 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGCACAGACTCTCGATTTCTCGCCTGATAACTCAGTCGTTTTTACTGGCAGCGTTTACCCTGCTGGCCG
GTTGTGTTTCGTCTTCACGCAGTGTCCCCGCGCAATACAGCCTGGTTTTTCAGGCTCACCCTCAGATCAA
TGATTCGGCTCCGCTAAAGGTGCGGGTGCTGTTGCTGAAGTCGGATGCGGATTTTATGGCGGCTGATTTC
TACTCGCTGCAAACCCATCCGCAGGCAGTGCTGGGGCAAAACCTGTTGAACAGTGAGCAGTTTTTCCTGA
TGCCGGGGCAGACTGACAAAAAACGGGTCGGGCAGAGCAGCCCGGAGGCGCGTTATATCGGCATTATGGC
GGAATATCAAACGCTTGATGGCAAAAAGTGGCGAGTTTCTTTGCCGGTGCCCCTTCCTGCCGAACGCCAT
TTTTATCAAATTTGGCAAGGGGATGCGGATAATCTGCGCGCCGACGTTATCGCCGATATCAACGGTGTCC
GTGTTATTAACGCCCGCGATTAA