SecReT6
Protein ID: 259907292
SecReT6 ID331
T6SS typei3
Gene symbol-
Locus tagEpC_06160
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]713335..714678 [+]
Producthypothetical protein
NoteTssK
UniProt IDD0FP52
KEGG IDepy:EpC_06160
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-140, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|259907292|ref|YP_002647648.1| hypothetical protein EpC_06160 [Erwinia pyrifoliae Ep1/96]
MSKAEKVVWTEGMFLRPHHFQQSENYLQSTLRDWGQAQRPWLWGLHDIEFDKSMLRQGKVALLSASGLLP
DGTAFAFYNGHDAPPPLFIPDNLTQAKVVLALPARRGGREEVIFSEAGDSLARFISFEREVDDFNAMAVG
QAAVQFGRLRLRLMLESELSAEWTAIGVARISEKRSDHQLRLDASYIPPMLNAINQSQLMEYIGDIHALL
AQRSQQIGQRLQQPGRFNTADMVDFMLLTLINQQLGHISHVKSLPLVHPETLFHGWLVFAAELTSWMPSR
TPDAALPVYQHDDLAGCFSQLLLLLRQGLSQVMEENALQLPLTERSHGLNVATVPESSMVREFGFVLAVR
ANVPAEAIQTHFPAQMKVAPVTKIRDLVQLQLPGIMLRAMPAAPPQIPWHAGYNYFQLDKGSELWQEMEK
SGTFALHLAGEFPGLEMEFWAIRSHSV
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|259906682|ref|NC_012214.1|:713335-714678 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAGCAAAGCAGAAAAAGTAGTCTGGACCGAAGGAATGTTTCTGCGTCCGCATCATTTTCAGCAGAGCG
AAAACTACCTGCAAAGCACGCTGCGCGACTGGGGACAGGCGCAGCGTCCGTGGCTTTGGGGTCTGCACGA
CATTGAATTTGATAAATCGATGCTGCGCCAGGGCAAAGTCGCGCTGCTCTCGGCCAGCGGCCTGCTGCCG
GACGGCACGGCGTTTGCCTTCTACAATGGTCACGACGCGCCACCGCCGCTCTTTATCCCCGATAATCTGA
CTCAGGCCAAAGTGGTACTGGCGCTGCCGGCAAGGCGCGGCGGGCGTGAAGAGGTGATCTTCAGCGAGGC
TGGTGATTCGCTGGCGCGCTTTATCAGCTTCGAGCGGGAAGTGGATGATTTTAACGCCATGGCGGTCGGT
CAGGCGGCGGTACAGTTTGGCCGTTTACGTCTGCGGCTGATGCTGGAAAGTGAACTGAGCGCCGAATGGA
CCGCCATCGGCGTGGCGCGCATCAGTGAAAAGCGCAGTGACCACCAACTGCGTCTGGACGCCAGCTATAT
CCCGCCGATGCTCAATGCCATCAACCAGTCGCAGCTGATGGAATACATAGGCGATATCCACGCCCTGCTG
GCGCAGCGCAGCCAGCAGATTGGCCAGCGCTTGCAGCAGCCTGGGCGCTTTAATACCGCCGACATGGTCG
ACTTTATGCTGCTGACGCTGATCAACCAGCAGCTGGGGCATATCAGCCATGTGAAAAGTCTGCCGCTTGT
CCATCCTGAAACGTTGTTTCACGGCTGGCTGGTGTTCGCGGCTGAACTGACCAGCTGGATGCCGTCGCGC
ACCCCGGACGCGGCGCTGCCGGTTTACCAACATGACGATCTGGCTGGTTGCTTTAGCCAGCTGCTGCTGC
TGCTACGTCAGGGGCTGTCGCAGGTGATGGAAGAGAATGCGCTGCAGCTGCCGCTGACCGAGCGCTCACA
CGGCCTGAACGTGGCTACGGTGCCGGAGTCCTCGATGGTGCGCGAGTTTGGCTTTGTGCTGGCGGTGCGC
GCCAACGTGCCGGCCGAAGCGATACAAACCCACTTCCCGGCGCAGATGAAAGTGGCTCCCGTCACCAAAA
TCCGCGATCTGGTCCAGCTGCAGCTGCCCGGCATTATGCTGCGGGCAATGCCGGCCGCTCCACCACAAAT
TCCGTGGCACGCTGGCTACAACTATTTTCAGCTCGATAAGGGCAGCGAACTGTGGCAGGAAATGGAAAAG
TCCGGCACCTTCGCGCTGCACCTGGCCGGCGAGTTCCCGGGGCTGGAGATGGAGTTCTGGGCAATCCGCA
GTCACTCAGTCTGA