SecReT6
Protein ID: 259907293
SecReT6 ID331
T6SS typei3
Gene symbolvasF
Locus tagEpC_06170
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]714696..715937 [+]
Producthypothetical protein
NoteTssL
UniProt IDD0FP53
KEGG IDepy:EpC_06170
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-71, Aligned region: 21..226
DUF2077 [PF09850], Evalue: 2.00E-71, Aligned region: 353..390
OmpA [PF00691], Evalue: 5.60E-16, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|259907293|ref|YP_002647649.1| hypothetical protein EpC_06170 [Erwinia pyrifoliae Ep1/96]
MIQERHSEAAQAGMGGANSHNPLVAAANPLLNAIPQIRHSISHPDPAGLRQRLVDEIRQFEMNCQRAGLP
WEVIIGARYCLCTALDEAAALTPWGGRGVWPGNGLLVTFHNETWGGEKFFQLLARLSQTPREQIALLELI
NFCLQLGFEGRYRVMDNGRSQLETIRQRLLQMIRSVRGGYAPPLSAHPEDHPVTRQLWRPVVPLWACTAV
VGFLACLLYILLNWRLGDYTSPVLASIYQTTLPEVSIHNPAPPQPAAVNLKTFLKPEIEQGLVVVRDEAD
RSVVTLKGDGLFTSASTDVRGRYAEVLDRVAAAMNNVSGRILVVGYSDNVPIRSARFASNYELSLARAQS
VSEQLQQHLTQPQRVKAEGRGDSNPLAPNNSAGNRARNRRVEITLLVSPGSTRAELNDMAQGN
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|259906682|ref|NC_012214.1|:714696-715937 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGATACAGGAAAGACATTCTGAAGCCGCCCAGGCGGGTATGGGCGGTGCCAACAGCCATAATCCTCTGG
TGGCCGCAGCGAACCCGCTGCTGAACGCCATTCCACAGATTCGCCATTCGATTTCTCATCCCGATCCGGC
CGGTTTACGCCAGCGGCTGGTCGATGAGATCCGCCAGTTTGAAATGAACTGTCAGCGCGCCGGGCTGCCG
TGGGAAGTGATCATTGGCGCGCGTTACTGTCTGTGTACCGCGCTGGACGAAGCGGCGGCGCTTACCCCGT
GGGGCGGGCGCGGCGTCTGGCCCGGCAACGGGCTGCTGGTCACCTTTCACAACGAAACCTGGGGCGGCGA
GAAGTTTTTCCAGCTGCTGGCGCGTCTGTCGCAGACGCCACGCGAACAAATCGCCCTGCTGGAGCTGATT
AACTTCTGCCTGCAGCTGGGCTTTGAGGGGCGCTACCGGGTGATGGACAACGGGCGATCCCAGTTGGAAA
CCATCAGGCAGCGCCTGTTGCAGATGATCCGCTCGGTGCGCGGTGGCTATGCGCCGCCGCTGTCGGCACA
TCCGGAAGATCACCCGGTGACGCGTCAACTGTGGCGTCCGGTGGTGCCGCTGTGGGCCTGTACCGCTGTG
GTGGGCTTCCTCGCCTGCCTGCTCTATATTCTGCTCAACTGGCGGCTGGGCGACTATACCAGCCCGGTGC
TGGCCTCAATTTACCAGACGACCCTACCCGAAGTCAGTATTCACAATCCCGCGCCGCCGCAGCCAGCAGC
GGTTAACCTGAAAACTTTCCTGAAACCGGAAATTGAACAGGGGCTGGTGGTGGTGCGCGATGAAGCCGAC
CGCAGCGTGGTGACGCTGAAAGGTGACGGCCTGTTCACCTCCGCATCGACCGACGTGCGTGGCCGCTACG
CCGAGGTGCTGGATCGCGTTGCCGCCGCCATGAACAACGTCAGCGGCCGCATCCTGGTGGTGGGCTACAG
TGATAACGTACCGATCCGCAGCGCACGCTTTGCCTCCAACTACGAGCTTTCCCTGGCGCGTGCGCAGTCG
GTCAGCGAACAATTGCAGCAGCATCTGACGCAGCCGCAGCGGGTCAAAGCGGAAGGGCGTGGCGATAGCA
ATCCGCTTGCGCCGAATAACAGCGCCGGCAATCGCGCCCGCAACCGACGCGTAGAAATCACGCTGCTGGT
GTCACCGGGCAGTACCCGGGCCGAGCTGAACGACATGGCGCAAGGAAATTAA