SecReT6
Protein ID: 259907296
SecReT6 ID331
T6SS typei3
Gene symbol-
Locus tagEpC_06200
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]720318..721325 [+]
Producttype VI secretion system-associated, ImpA protein
NoteTssA
UniProt IDD0FP56
KEGG IDepy:EpC_06200
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-19, Aligned region: 52..111
Protein Sequence: 335 a.a.     [Download]
>gi|259907296|ref|YP_002647652.1| type VI secretion system-associated, ImpA protein [Erwinia pyrifoliae Ep1/96]
MNLEALLAPVTPDRPCGENLEYDADYMAMDQASAGKAEQQFGDTIIPAEPADWNKVERLALDLLGRSKDL
RVMLALTRAWTQLRGLSGYADGLQLIQQALLLYWQPLWPSLEEDGVEDPFYRLNALAALGDKSALTGALR
QAPLLRYATDEISLRDACALLDGSKTECSGYPGGRARLQDELARGGQPGIEAVIKISERLLTIRETLTEQ
LGATALPEMEQLLKTINTVAAGCQATDLNTLIPQTETAASSATPPPAAQLHADWRSVQLGSRSDAQLMLE
KVKQYFSQHEPSHPAPLMIGRVQRMIELDFMDIIRDLAPDGVHQLETIFGRRDHS
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|259906682|ref|NC_012214.1|:720318-721325 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAATCTTGAAGCGCTGCTGGCCCCGGTCACGCCTGACCGCCCCTGTGGGGAAAACCTTGAATATGACG
CCGACTACATGGCGATGGACCAGGCCAGCGCCGGTAAAGCCGAACAGCAGTTTGGCGATACCATCATTCC
GGCGGAACCGGCGGACTGGAACAAAGTCGAGCGGCTGGCGCTGGATCTGCTGGGGCGCAGCAAAGATCTG
CGCGTGATGCTGGCGCTAACCCGCGCCTGGACCCAGCTGAGAGGGTTGAGCGGCTATGCCGACGGCCTGC
AGCTGATCCAGCAGGCGCTGCTGCTTTACTGGCAGCCGCTGTGGCCGTCACTGGAAGAAGATGGCGTAGA
GGATCCGTTTTACCGCCTTAACGCGCTGGCGGCGCTGGGGGACAAATCGGCACTGACCGGCGCGTTGCGC
CAGGCTCCGCTGCTGCGCTATGCCACCGACGAAATCAGTCTGCGTGACGCCTGTGCGCTGCTCGACGGCA
GCAAAACCGAATGCTCCGGCTATCCCGGTGGCCGCGCCCGCCTGCAGGATGAGCTGGCGCGTGGAGGGCA
GCCCGGTATTGAAGCGGTCATTAAGATAAGTGAGCGGTTACTGACAATTCGCGAGACCCTGACCGAACAG
CTGGGCGCTACGGCCCTGCCGGAAATGGAGCAGCTGCTGAAAACCATTAATACCGTGGCTGCCGGCTGTC
AGGCCACCGACCTCAACACCCTGATCCCCCAGACGGAAACCGCCGCCAGCAGCGCTACGCCGCCGCCCGC
CGCCCAGCTGCACGCCGACTGGCGCAGCGTGCAGCTGGGTTCGCGCAGCGATGCGCAGCTGATGCTGGAA
AAGGTCAAACAGTATTTCAGCCAGCACGAGCCAAGCCATCCCGCCCCGCTGATGATCGGGCGGGTACAAC
GCATGATAGAGCTGGACTTTATGGACATTATCCGCGATCTCGCCCCGGACGGCGTACACCAGCTGGAGAC
GATTTTCGGGCGTCGCGACCACTCATAG