SecReT6
Protein ID: 259907297
SecReT6 ID331
T6SS typei3
Gene symbol-
Locus tagEpC_06210
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]721388..721924 [+]
Producthypothetical protein
NoteTssB
UniProt IDD0FP57
KEGG IDepy:EpC_06210
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.90E-59, Aligned region: 12..162
Protein Sequence: 178 a.a.     [Download]
>gi|259907297|ref|YP_002647653.1| hypothetical protein EpC_06210 [Erwinia pyrifoliae Ep1/96]
MAVSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMSDLVGKPLDPQPGVDERKFLEIDVDN
FDERMKALKPRVAFQAENTLTGEGRLNIDLTFNSMEDFSPDAVARKVEPLNQLLDARTQLANLLTYMDGK
NGAEELIGKILQDPTLLQSLSHLPKADDKAADDHGNKE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|259906682|ref|NC_012214.1|:721388-721924 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGGCAGTCAGTAAATCCAGTGGGCAAAAATTCATTGCCCGTAACCGCGCGCCACGCGTGCAGATTGAGT
ACGACGTGGAAATCTATGGTGCGGAACGCAAAATCCAGCTGCCCTTCGTGATGGGCGTGATGTCCGACCT
GGTCGGGAAACCGCTGGATCCGCAGCCGGGCGTTGATGAACGTAAGTTCCTTGAAATCGACGTCGACAAC
TTCGACGAACGCATGAAGGCGCTCAAACCACGCGTGGCATTCCAGGCAGAAAACACCCTGACCGGAGAAG
GGCGTCTTAATATCGATCTGACCTTTAACAGCATGGAAGACTTCTCGCCGGATGCGGTGGCACGTAAAGT
CGAGCCACTCAATCAGCTGCTGGATGCCCGTACCCAGCTGGCTAACCTGCTGACCTATATGGATGGCAAA
AACGGTGCGGAAGAACTGATCGGCAAAATCCTGCAGGACCCGACGCTGCTGCAATCACTCAGCCATCTGC
CGAAAGCTGACGACAAGGCAGCCGACGACCACGGCAACAAGGAGTAA