SecReT6
Protein ID: 259907298
SecReT6 ID331
T6SS typei3
Gene symbol-
Locus tagEpC_06220
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]721928..723427 [+]
Producthypothetical protein
NoteTssC
UniProt IDD0FP58
KEGG IDepy:EpC_06220
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.90E-196, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|259907298|ref|YP_002647654.1| hypothetical protein EpC_06220 [Erwinia pyrifoliae Ep1/96]
MSNPFQQSGDLQQQAYSEDAFSALLNKEFRPKSDQARAAVESAVKTLAQQALENSVTVSNDAYRTIQALI
AEIDDKLSQQVNQIIHHEDFQQLEGAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVSWDQS
PIFKKIYEEEYGQFGGEPFGCLVGDYYFDHGPQDVELLSEMARIGSAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHGNYTWTN
AAYAMAANINRSFKDFGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNDA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|259906682|ref|NC_012214.1|:721928-723427 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAGCAACCCATTCCAACAGTCAGGCGATTTGCAGCAGCAGGCCTACAGCGAGGACGCGTTCAGCGCGC
TGCTGAATAAAGAGTTCCGCCCGAAAAGCGACCAGGCGCGCGCGGCGGTGGAAAGCGCGGTGAAAACCCT
TGCGCAGCAGGCGCTGGAAAATAGCGTTACCGTCTCCAACGATGCCTACCGCACCATCCAGGCGCTGATT
GCCGAGATCGACGACAAGCTTTCCCAGCAGGTCAACCAGATTATCCACCATGAAGACTTCCAGCAGCTGG
AAGGGGCGTGGCGCGGCCTGAGCTATCTGGTTAACAACACCGAAACCGACGAGATGCTGAAAATCCGCTT
TATGAGCATCTCTAAGCAGGAGCTGGGCCGCACCCTGAAACGCTATAAGGGCGTCAGCTGGGATCAAAGC
CCGATCTTTAAGAAGATCTATGAGGAAGAGTACGGCCAGTTCGGCGGCGAACCCTTTGGCTGCCTGGTGG
GCGACTACTACTTCGATCACGGCCCACAGGACGTGGAGCTGCTAAGCGAAATGGCGCGTATCGGCTCTGC
CGCCCACTGTCCGTTTATCACCGGCACCGCGCCGGGAGTGATGCAGATGGAGTCCTGGCAGGAGCTGGCC
AACCCGCGTGACCTGACCAAAATCTTCCAGAATACCGAATACGCCGCCTGGCGCAGCCTGCGTGAATCGG
AAGATGCGCGCTACCTCGGCCTGGTGATGCCGCGCTTCCTGTCGCGTCTGCCTTATGGCATCCGCACCAA
CCCGGTGGACAGCTTCGACTTTGAAGAGCAGACCGACGGCGCTAACCACGGCAACTACACCTGGACCAAC
GCCGCCTACGCGATGGCGGCCAATATCAACCGCTCGTTTAAAGATTTTGGCTGGTGTACCTCGATCCGTG
GCGTCGAGTCCGGCGGCGCGGTGGAAAACCTGCCGTGCCACACCTTCCCGAGCGACGACGGCGGCGTGGA
CATGAAATGCCCGACCGAAATCGCCATCAGCGACAGGCGTGAAGCCGAGCTGGCGAAAAACGGCTTTATG
CCGCTGGTGCACCGCAAGAACTCCGATTTTGCCGCCTTTATCGGCGCACAGTCGCTGCAAAAACCGGCGG
AGTACCACGATGCCGACGCCACCGCTAACGCCCGACTGGCGGCGCGCCTGCCGTATCTGTTCGCCTGCTG
CCGCTTTGCTCACTACCTGAAGTGCATCGTGCGCGACAAGATTGGCTCCTTCCGCGAGCGCGACGAGATG
GAGCGCTGGCTGAACGACTGGGTGATGAACTACGTTGACGGTGACCCGGCTAACTCCTCGCAGGAAACCA
AATCACGCAAGCCGCTGGCTGCCGCTGAGGTGCAGGTGCAGGAGATCGAAGATAACCCGGGCTACTACGC
GGCCAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGTCTTACCGTGTCGCTGCGCCTGGTGTCCAAA
CTGCCGTCGCTGAAATCGAACGACGCGTGA