SecReT6
Protein ID: 259907308
SecReT6 ID331
T6SS typei3
Gene symbol-
Locus tagEpC_06320
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]732562..733383 [+]
Producthypothetical protein
NoteTagJ
UniProt IDD0FP68
KEGG IDepy:EpC_06320
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.30E-40, Aligned region: 143..266
Protein Sequence: 273 a.a.     [Download]
>gi|259907308|ref|YP_002647664.1| hypothetical protein EpC_06320 [Erwinia pyrifoliae Ep1/96]
MHSLQHLMDGQSLAETLARIESQIKRQPADADLRASFVQLLCLAGNWSRAQTQLKSWLALKPQAQPTVQL
LDQTINAERQRAAVFAGEASPRMPGAAWNWAEQLLAALAADAAGDRAQAQRLRGCALEAAQLNPGQLTHQ
NQQQTFDWLTDGDGRLGPVCELIANGQYSWLPFSAISEIRFQAPVSVTDLVWRHTLVRLVDGSEQVCQIP
VRYPFVEQADDRYRLATLTEWQPLPGDDQQFSGHGQKCWFSADAEFPLLGMEMLAFSDAEPAL
 
Nucleotide Sequence: 822 bp     [Download]
>gi|259906682|ref|NC_012214.1|:732562-733383 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGCATTCGTTACAACATCTGATGGACGGCCAGTCGCTGGCTGAAACTCTGGCAAGAATCGAAAGCCAGA
TAAAACGCCAGCCTGCCGATGCCGATCTGCGCGCCAGCTTTGTCCAGCTGCTGTGCCTGGCGGGCAACTG
GAGCCGGGCGCAGACGCAGCTAAAATCCTGGCTGGCGCTGAAACCACAGGCGCAGCCCACGGTCCAGCTG
CTGGACCAGACGATTAACGCTGAACGCCAGCGTGCGGCGGTATTTGCCGGTGAAGCATCACCGCGTATGC
CGGGCGCGGCATGGAATTGGGCAGAGCAGCTGCTGGCCGCGCTGGCGGCCGATGCCGCTGGCGATCGTGC
TCAGGCGCAACGGCTGCGCGGCTGCGCTTTAGAAGCGGCGCAGCTGAATCCCGGGCAGTTGACGCACCAG
AACCAGCAGCAAACCTTTGACTGGCTTACAGACGGTGACGGGCGGCTCGGCCCGGTGTGCGAACTGATTG
CCAACGGACAGTACAGCTGGCTGCCGTTCAGCGCCATCAGCGAAATACGCTTTCAGGCTCCGGTCAGCGT
CACCGACCTGGTATGGCGGCATACGCTGGTCAGACTGGTGGATGGCAGCGAGCAGGTGTGCCAGATACCG
GTACGCTATCCGTTTGTCGAACAGGCCGACGACCGCTACCGGCTGGCCACGCTGACCGAATGGCAACCGC
TGCCGGGCGATGACCAGCAGTTCAGCGGCCACGGGCAGAAATGCTGGTTCAGCGCCGACGCCGAATTCCC
GCTGCTGGGCATGGAGATGCTGGCGTTTAGCGATGCAGAGCCAGCCTTATGA