SecReT6
Protein ID: 259907309
SecReT6 ID331
T6SS typei3
Gene symbol-
Locus tagEpC_06330
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]733380..733946 [+]
Producthypothetical protein
NoteTssE
UniProt IDD0FP69
KEGG IDepy:EpC_06330
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.60E-19, Aligned region: 57..167
Protein Sequence: 188 a.a.     [Download]
>gi|259907309|ref|YP_002647665.1| hypothetical protein EpC_06330 [Erwinia pyrifoliae Ep1/96]
MSQHSDEGHKLLHGGYRQRRQQEGLNIRDKMQPSLLDRLTDNAPDNPREAAHSTLISHSALRRNVLRDLQ
WLFNTINNEAQQDLSPFPHVQRSTLNFGISPLAGQRMSDIEWQDIQRKLSAAILNFEPRILPAGLQVRCV
SDTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFALRDMG
 
Nucleotide Sequence: 567 bp     [Download]
>gi|259906682|ref|NC_012214.1|:733380-733946 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGAGCCAGCACAGCGATGAAGGGCATAAGCTGCTGCACGGCGGTTACCGCCAGCGCCGCCAGCAGGAAG
GGCTGAACATCCGCGACAAAATGCAGCCATCGCTGCTCGATCGTCTGACCGACAACGCGCCGGATAATCC
GCGTGAAGCGGCGCACAGCACGCTGATCTCGCACAGCGCGCTGCGGCGCAACGTGCTGCGCGACCTGCAG
TGGCTGTTTAATACCATTAACAATGAAGCGCAGCAGGATCTGTCACCATTCCCGCATGTACAGCGTTCGA
CGCTGAACTTTGGCATTTCGCCGCTGGCGGGGCAGCGCATGTCGGATATTGAATGGCAGGATATCCAGCG
CAAGCTAAGCGCGGCGATCCTCAACTTCGAACCGCGCATTCTGCCCGCCGGGTTACAGGTGCGCTGCGTG
TCCGACACCAGCTCGCTTGACCTGCACAACGTGTTGTCGATTGAGATCAAGGGCCGCCTGTGGTGCGTGC
CGTATCCGCTGGAATTTCTGTTTCGTACCGATGTGGATCTGGAAAACGGCCATTTTGCCCTGCGTGATAT
GGGTTAA