SecReT6
Protein ID: 259907310
SecReT6 ID331
T6SS typei3
Gene symbolvasA
Locus tagEpC_06340
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]733965..735839 [+]
Producttype VI secretion system family protein, VCA0110
NoteTssF
UniProt IDD0FP70
KEGG IDepy:EpC_06340
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-209, Aligned region: 6..624
Protein Sequence: 624 a.a.     [Download]
>gi|259907310|ref|YP_002647666.1| type VI secretion system family protein, VCA0110 [Erwinia pyrifoliae Ep1/96]
MDSKQLDYYNRELAYLREMGAEFAGRYPKVAGRLGMRGDEVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMIAPNYLSPTPSMAIAELQPDSRKGDISNGFLVPRGTMMDSQALKQNGVTCSYTTAHDVMLQP
VRIKSVELGGIPANVPLGELGLSQRGAVSALRIRIACDESITLAHLSFDSLMFFLSGPDMQALQLLELVM
QHYVGGYCQSVGSSPQRTLLGDDALQQEGFAADQALLPNDLRNFDGYRLLQEYFAFPARFQFISISQLRP
LLQACDPQAREFDIVLLLDSANPGLERVIDHSHLALHCTPVINLFPKVAQRQKLSDSVHEYHLVVDNIRP
LDYEIFSVQKLYASGERQREEQQFRPFWSTFSDDGGNYGAYFSLRREQRTLSEHAQRFGTRTGYVGSEVF
LSLVDEHNSPWHEDLRYLTAEVMCTSRDLPLLLLQQQGQFVMPDSIPVRQLTLRKGPTPPRPALAEGKMA
WRLVSHLQMNYLSLMDGDDGQGAAALRQMLGLYANLAEAAAARQIDGIRHCQLKPVFRRVPEPGPIVFAR
GIGIELEVDEQAFSGSSPWLLGSVLERVFSRLVAINTFTEMTLTSQQRGEVGYWAPRMGKRTLI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|259906682|ref|NC_012214.1|:733965-735839 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGGACAGTAAGCAGCTCGACTATTACAACCGTGAACTGGCGTATCTGCGCGAAATGGGCGCGGAGTTTG
CCGGGCGCTATCCAAAGGTGGCAGGCCGTCTTGGCATGCGCGGCGATGAGGTGGCCGACCCCTACGTTGA
GCGGCTGATGGAGGGCTTTGCCTTTCTCACCTCACGCGTGCAGCTGAAAATGGACGCCGAGTTTCCGCGC
TTCTCCCAGCGCCTGCTGGAGATGATTGCGCCGAACTACCTGTCGCCAACGCCGTCGATGGCGATAGCCG
AACTGCAGCCGGACAGCCGCAAAGGCGATATCAGCAACGGTTTTCTGGTGCCGCGCGGCACCATGATGGA
CAGCCAGGCGCTAAAGCAAAACGGCGTCACCTGCAGTTACACCACCGCCCATGACGTGATGCTGCAACCG
GTGCGCATCAAAAGCGTTGAGCTGGGCGGCATTCCGGCCAACGTCCCGCTCGGCGAACTGGGGTTAAGCC
AGCGCGGCGCGGTCAGCGCCCTGCGCATCCGCATCGCCTGTGACGAGAGCATCACGCTTGCACATCTTAG
CTTCGACAGCCTGATGTTCTTCCTCAGCGGGCCGGATATGCAGGCGCTGCAGCTGCTGGAGCTGGTGATG
CAGCACTACGTGGGCGGCTACTGCCAGAGCGTGGGCAGCAGCCCGCAGCGCACGCTACTGGGCGATGATG
CGCTCCAGCAGGAAGGGTTTGCCGCAGACCAGGCGCTGCTGCCAAACGATCTGCGTAATTTCGATGGCTA
TCGCCTGTTGCAGGAGTACTTCGCCTTCCCGGCCCGCTTCCAGTTTATCAGCATCAGCCAGCTGCGCCCG
CTGTTACAAGCCTGTGACCCACAGGCGCGTGAATTCGATATCGTGCTGCTGCTGGACAGCGCCAACCCGG
GGCTGGAGCGGGTGATTGACCACAGCCATCTGGCGCTGCACTGCACCCCGGTAATCAACCTGTTTCCGAA
AGTGGCGCAGCGGCAAAAGCTCAGCGACAGCGTGCACGAATATCATCTGGTGGTGGATAACATCCGCCCG
CTGGACTACGAGATTTTCTCGGTGCAGAAGCTATACGCCAGTGGCGAGCGCCAGCGCGAGGAGCAGCAGT
TCCGCCCGTTCTGGAGCACCTTCAGCGATGACGGCGGTAACTACGGGGCTTACTTCTCGCTGCGGCGCGA
ACAGCGCACCCTGTCCGAACATGCGCAGCGCTTCGGCACGCGCACCGGCTACGTCGGGTCGGAAGTGTTT
CTGTCGCTGGTCGACGAGCACAATTCGCCCTGGCATGAGGATCTGCGCTATCTGACTGCCGAGGTGATGT
GTACCAGCCGCGATCTGCCGCTACTGCTGCTGCAACAGCAGGGGCAGTTTGTGATGCCTGATTCGATCCC
GGTGCGCCAGCTTACGCTGCGTAAAGGGCCGACGCCGCCACGTCCGGCGCTGGCCGAGGGAAAAATGGCC
TGGCGGCTGGTCAGCCATTTGCAGATGAACTATCTCAGCCTGATGGACGGTGATGACGGGCAGGGGGCGG
CGGCGTTACGCCAGATGCTCGGGCTTTACGCTAATCTCGCCGAAGCCGCTGCGGCGCGCCAGATCGACGG
TATTCGCCACTGCCAGCTGAAGCCGGTGTTCCGGCGCGTGCCGGAGCCTGGCCCGATTGTCTTTGCCCGT
GGCATCGGCATTGAGCTGGAGGTGGACGAGCAGGCGTTTTCCGGCAGCAGCCCGTGGCTACTCGGCAGCG
TGCTGGAGCGGGTGTTCTCGCGGCTGGTGGCGATCAACACCTTTACCGAAATGACGCTGACCAGCCAGCA
GCGCGGCGAGGTCGGCTACTGGGCGCCGCGCATGGGCAAAAGGACACTGATATGA