SecReT6
Protein ID: 259907311
SecReT6 ID331
T6SS typei3
Gene symbol-
Locus tagEpC_06350
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]735836..736894 [+]
Producthypothetical protein
NoteTssG
UniProt IDD0FP71
KEGG IDepy:EpC_06350
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.00E-106, Aligned region: 28..332
Protein Sequence: 352 a.a.     [Download]
>gi|259907311|ref|YP_002647667.1| hypothetical protein EpC_06350 [Erwinia pyrifoliae Ep1/96]
MTQQPAAQAEKIHRLHRLPPDFWAALCATPWRYDLFQLLRRLDAQGGHRYPLGRAPLPRHEPLRIGQRPS
LAFAPAAIAGVTPRENSALHDVSIYSFGLFGPNGPLPVHLTEYARERSDHHQDNSLSAFADLFHHRLTLL
FYRAWADAQPTVALDRAEKRQFERWLASLIGMGQPGQLKQGSLSAHSRLALAGHLTRHARDAEGLQKVLS
HYFQVPVRLVENVPHWQPVDRRDRASLGAGRRKPRLGVSAFLGVAVRDVQHKLRLDLGPLPMASYQRFLP
GEPWAVQLRDWVRQYLGIEFLWEVRLILDAADVQGVTLGGASRLGYSSWLGQPAIPQHRSDLTFSPEPQE
SV
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|259906682|ref|NC_012214.1|:735836-736894 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGACACAGCAGCCCGCCGCGCAGGCAGAGAAAATTCACCGCCTGCATCGCCTGCCGCCGGACTTCTGGG
CGGCGCTGTGCGCCACGCCGTGGCGCTATGACCTGTTCCAGCTGCTGCGGCGGCTGGATGCGCAGGGCGG
TCACCGCTATCCGCTGGGGCGTGCGCCGCTGCCGCGCCACGAACCGCTGCGCATCGGCCAGCGGCCGTCG
CTGGCCTTTGCCCCGGCGGCCATCGCCGGCGTCACGCCGCGTGAAAACAGTGCGCTGCACGATGTCTCGA
TCTACAGCTTCGGCCTGTTTGGCCCCAACGGCCCGCTGCCTGTCCATCTGACGGAATATGCGCGTGAGCG
CAGCGACCACCACCAGGACAACAGCCTGAGCGCCTTTGCCGATCTGTTCCACCATCGCCTGACGCTGCTG
TTTTACCGCGCCTGGGCAGATGCGCAGCCCACGGTGGCGCTGGACCGGGCGGAAAAACGCCAGTTTGAGC
GCTGGCTCGCCAGCCTGATCGGCATGGGGCAGCCGGGGCAGCTAAAACAGGGCAGCCTCAGTGCGCATTC
ACGGCTGGCGCTGGCCGGGCATCTGACCCGCCACGCCCGCGATGCCGAGGGACTGCAAAAAGTCCTCAGT
CACTACTTTCAGGTGCCGGTGCGGCTGGTGGAAAACGTGCCTCACTGGCAGCCGGTTGACCGTCGCGACC
GCGCCAGCCTGGGGGCCGGACGGCGCAAACCGCGACTCGGGGTTTCTGCGTTTCTCGGCGTGGCGGTGCG
CGATGTGCAGCACAAGTTACGTCTGGATCTGGGACCGCTGCCAATGGCCAGCTACCAGCGTTTTCTGCCC
GGCGAACCCTGGGCGGTGCAGCTGCGCGACTGGGTGCGTCAGTATCTGGGCATTGAATTTCTCTGGGAGG
TGCGGCTGATCCTTGACGCCGCCGATGTGCAGGGCGTCACCCTCGGCGGCGCATCCCGGCTGGGATACAG
CAGCTGGCTGGGACAGCCGGCTATCCCACAGCACCGCAGCGATCTCACCTTTAGTCCGGAGCCGCAGGAA
AGTGTTTAA