SecReT6
Protein ID: 259907314
SecReT6 ID331
T6SS typei3
Gene symbol-
Locus tagEpC_06380
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]738110..740725 [+]
Producttype VI secretion system family ATPase, ClpV1
NoteTssH
UniProt IDD0FP74
KEGG IDepy:EpC_06380
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.60E-41, Aligned region: 223..245
AAA_2 [PF07724], Evalue: 7.60E-41, Aligned region: 602..767
AAA [PF00004], Evalue: 4.50E-21, Aligned region: 223..355
AAA [PF00004], Evalue: 4.50E-21, Aligned region: 372..392
AAA [PF00004], Evalue: 4.50E-21, Aligned region: 608..692
ClpB_D2-small [PF10431], Evalue: 2.40E-16, Aligned region: 775..850
AAA_5 [PF07728], Evalue: 6.10E-13, Aligned region: 223..300
AAA_5 [PF07728], Evalue: 6.10E-13, Aligned region: 607..727
AAA_16 [PF13191], Evalue: 3.20E-08, Aligned region: 33..81
AAA_16 [PF13191], Evalue: 3.20E-08, Aligned region: 200..243
AAA_16 [PF13191], Evalue: 3.20E-08, Aligned region: 268..302
AAA_16 [PF13191], Evalue: 3.20E-08, Aligned region: 604..652
AAA_16 [PF13191], Evalue: 3.20E-08, Aligned region: 672..689
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 223..304
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 371..390
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 606..631
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 669..690
Sigma54_activat [PF00158], Evalue: 3.60E-07, Aligned region: 208..238
Sigma54_activat [PF00158], Evalue: 3.60E-07, Aligned region: 607..723
AAA_14 [PF13173], Evalue: 1.70E-06, Aligned region: 223..313
AAA_14 [PF13173], Evalue: 1.70E-06, Aligned region: 329..389
AAA_14 [PF13173], Evalue: 1.70E-06, Aligned region: 606..717
AAA_25 [PF13481], Evalue: 5.30E-06, Aligned region: 222..247
AAA_25 [PF13481], Evalue: 5.30E-06, Aligned region: 276..320
AAA_25 [PF13481], Evalue: 5.30E-06, Aligned region: 471..500
AAA_25 [PF13481], Evalue: 5.30E-06, Aligned region: 598..629
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 223..259
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 608..634
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 222..247
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 605..629
IstB_IS21 [PF01695], Evalue: 2.50E-05, Aligned region: 206..242
IstB_IS21 [PF01695], Evalue: 2.50E-05, Aligned region: 607..627
IstB_IS21 [PF01695], Evalue: 2.50E-05, Aligned region: 718..740
AAA_17 [PF13207], Evalue: 3.40E-05, Aligned region: 223..264
AAA_17 [PF13207], Evalue: 3.40E-05, Aligned region: 607..643
Zeta_toxin [PF06414], Evalue: 4.60E-05, Aligned region: 222..243
Zeta_toxin [PF06414], Evalue: 4.60E-05, Aligned region: 601..657
Zeta_toxin [PF06414], Evalue: 4.60E-05, Aligned region: 782..816
Clp_N [PF02861], Evalue: 0.0001, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.0001, Aligned region: 106..123
Clp_N [PF02861], Evalue: 0.0001, Aligned region: 310..320
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 223..243
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 609..632
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 796..857
AAA_29 [PF13555], Evalue: 0.00046, Aligned region: 214..239
AAA_29 [PF13555], Evalue: 0.00046, Aligned region: 605..632
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 202..237
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 276..307
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 360..396
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 606..646
FtsK_SpoIIIE [PF01580], Evalue: 0.0023, Aligned region: 209..266
FtsK_SpoIIIE [PF01580], Evalue: 0.0023, Aligned region: 468..511
FtsK_SpoIIIE [PF01580], Evalue: 0.0023, Aligned region: 606..625
RNA_helicase [PF00910], Evalue: 0.0024, Aligned region: 224..244
RNA_helicase [PF00910], Evalue: 0.0024, Aligned region: 608..629
RNA_helicase [PF00910], Evalue: 0.0024, Aligned region: 705..726
SRP54 [PF00448], Evalue: 0.0064, Aligned region: 222..243
SRP54 [PF00448], Evalue: 0.0064, Aligned region: 606..640
RuvB_N [PF05496], Evalue: 0.0067, Aligned region: 221..240
RuvB_N [PF05496], Evalue: 0.0067, Aligned region: 278..303
RuvB_N [PF05496], Evalue: 0.0067, Aligned region: 576..628
RuvB_N [PF05496], Evalue: 0.0067, Aligned region: 676..700
T2SE [PF00437], Evalue: 0.0072, Aligned region: 207..240
T2SE [PF00437], Evalue: 0.0072, Aligned region: 604..684
Protein Sequence: 871 a.a.     [Download]
>gi|259907314|ref|YP_002647670.1| type VI secretion system family ATPase, ClpV1 [Erwinia pyrifoliae Ep1/96]
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQHQGGDLQQLIRHFSLDEEALTRD
IVAALDRLPRGASAVSDLSEHIDSAVERAWVYGSLKFGVQQIRGGHLLIGLLKTFNLANLLKGISPQFSR
ISVDVLLEQFDQVFGDSKEAQQVSAAPQTASGEIPQQQGTLAQYAQDLTARARDGKIDPVAGRDQEIRQM
VDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIAAGDVPEPLQQVQLWLLDIGMLQAGAGMKGEFEARLQ
ALINEVQSSPTPIVLFIDEIHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALT
RRFQTVQVHEPDEEKALLMLRSTVSPLEQHHCVLLLDEAVAAAVKLSHRYIPARQLPDKAVALLDTACAR
VAVSQSAQPPQLEDCLHRIHALEIERDIAGREAKVGIGEAGRVAQLEQQLAALAEQRDRLNERWQQERAL
VDDIIALRGQLSAETAEDQASLHQQLTARQQQLRELQGEAPLLFAAVDANVVAAVVADWTGIPLGRMVKN
EIDAVLKLADTLNQRVIGQRHGLDLIAKRVRTSRARLDDPNKPVGVFMLCGPSGVGKTETALALAETLYG
GEQNIITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVF
DKGWMEDGEGRHIDFRNTIIILTSNVGTQLISAMCADPELMPQPEDLAGALRPPLLEVFPPALLGRLLVV
PYYPLSDEVLANIVRLQLQRIQRRLEENHGIISEVDDSVISQIVQRCTEVESGGRMVDAILTNTLLPQMS
QMLLSASARDEQYRRLRVTLHQGEFQCQFEA
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|259906682|ref|NC_012214.1|:738110-740725 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGTCAGAAATCAGCCGCGCCGTACTGTTCGGCAAACTGGATACGCTGTTATTTACCTCTCTGGAGAGCG
CCACCGCGTTTTGTAAACTGCGCGGCAACCCCTATGTGGAGCTGGTGCACTGGCTGCACCAGCTGATGCA
GCATCAGGGCGGTGACTTACAGCAGCTTATCCGCCATTTTTCACTGGATGAAGAGGCGCTGACGCGGGAT
ATCGTGGCGGCGCTCGACAGGCTGCCGCGCGGAGCCAGCGCGGTCTCTGACCTGTCCGAACATATCGACA
GCGCGGTGGAGCGCGCCTGGGTTTACGGTTCGCTGAAGTTTGGCGTACAGCAGATCCGTGGCGGTCACCT
GCTGATTGGCCTGCTGAAAACCTTTAACCTCGCCAACCTGCTGAAAGGCATCTCGCCGCAGTTCAGCCGC
ATCAGCGTTGATGTGCTGCTGGAGCAGTTTGATCAGGTATTTGGCGACAGCAAAGAGGCACAGCAGGTCA
GCGCCGCGCCGCAGACTGCCAGCGGTGAAATCCCACAGCAGCAGGGTACGCTGGCGCAGTACGCGCAGGA
TCTGACGGCGCGCGCGCGCGATGGCAAGATCGATCCGGTGGCCGGGCGCGACCAGGAGATCCGCCAGATG
GTGGATATTCTGATGCGCCGCCGCCAGAACAACCCGCTACTCACCGGGGAAGCCGGGGTAGGCAAAACGG
CGGTGGTGGAAGGGCTGGCGCTGCGTATCGCCGCAGGCGACGTGCCTGAACCGTTGCAGCAGGTGCAGCT
GTGGCTGCTGGATATCGGCATGTTGCAGGCCGGAGCCGGGATGAAGGGTGAATTTGAGGCGCGGCTTCAG
GCGTTGATTAATGAAGTGCAGTCCAGCCCGACGCCGATCGTCCTGTTTATTGATGAGATCCACACCCTGG
TCGGCGCGGGCGGTCAGCAGGGTACCGGCGATGCCGCCAACCTGCTGAAACCGGCGCTGGCACGCGGCCA
GCTGCGCACCATCGGTGCCACCACCTGGGCGGAATACAAAAAGTACATCGAGAAAGATCCGGCGCTGACC
CGCCGCTTCCAGACCGTGCAGGTGCACGAGCCGGACGAGGAGAAAGCGCTGCTGATGCTGCGCAGTACCG
TCAGTCCGCTGGAACAGCACCACTGCGTCCTGCTGCTGGATGAAGCGGTAGCGGCGGCGGTCAAGCTCTC
GCATCGCTATATTCCGGCGCGTCAGTTGCCGGATAAGGCGGTGGCGCTGCTGGATACCGCCTGCGCACGC
GTTGCCGTCAGCCAGAGCGCCCAGCCACCGCAGCTGGAAGACTGCCTGCATCGCATTCATGCGCTGGAGA
TTGAGCGCGATATCGCCGGGCGTGAAGCGAAAGTCGGTATCGGCGAGGCCGGGCGCGTGGCGCAGTTGGA
GCAGCAGCTGGCGGCGCTGGCCGAACAGCGCGACAGGCTTAACGAACGCTGGCAGCAGGAGCGCGCGCTG
GTGGACGACATCATCGCCCTGCGCGGGCAGCTGAGTGCAGAGACGGCGGAAGACCAGGCGAGCCTGCATC
AGCAGCTTACCGCACGCCAGCAGCAGCTGCGTGAACTTCAGGGCGAAGCCCCGCTGCTGTTCGCGGCGGT
GGATGCCAACGTGGTGGCGGCGGTGGTCGCCGACTGGACCGGCATTCCGCTGGGGCGCATGGTGAAAAAC
GAAATTGATGCGGTGCTCAAGCTGGCTGATACCCTTAATCAGCGGGTGATTGGTCAGCGCCACGGGCTTG
ACCTGATCGCCAAACGGGTGCGCACCTCGCGCGCACGCCTGGACGACCCGAACAAGCCGGTCGGGGTCTT
TATGCTGTGCGGGCCATCCGGGGTGGGTAAAACCGAAACCGCGCTGGCGCTGGCGGAAACGCTGTACGGC
GGCGAACAGAATATTATCACCATCAATATGAGTGAGTTCCAGGAAGCGCATACCGTTTCCACCCTGAAAG
GTGCGCCGCCGGGTTATGTCGGCTATGGTGAGGGCGGAGTCCTGACCGAAGCGGTACGCCGCCGTCCGTA
CAGCGTGGTGCTGCTGGATGAAATTGAAAAGGCGCACCCGGACGTGCATGAAATCTTCTTCCAGGTGTTT
GATAAGGGCTGGATGGAGGATGGCGAAGGGCGGCATATCGATTTCCGCAACACCATCATTATTCTCACCT
CTAACGTCGGTACGCAGCTGATTAGCGCCATGTGTGCTGACCCGGAACTGATGCCGCAGCCGGAGGATCT
GGCCGGAGCGCTGCGCCCGCCGCTGCTGGAGGTGTTCCCCCCGGCGCTGCTGGGCCGCCTGCTGGTGGTG
CCTTACTATCCGCTCAGTGATGAGGTGCTGGCCAATATCGTGCGTCTGCAATTACAGCGTATTCAGCGGC
GGCTGGAGGAGAATCACGGTATTATCTCCGAAGTGGATGACAGCGTGATTAGCCAGATTGTCCAGCGCTG
TACCGAAGTGGAGTCCGGCGGTCGCATGGTCGACGCCATTCTTACCAATACCCTGTTGCCGCAAATGAGC
CAGATGCTGCTGTCTGCCAGCGCGCGCGACGAACAATACCGTCGCCTGCGCGTTACGTTACATCAGGGCG
AATTCCAGTGTCAGTTTGAGGCGTAA