SecReT6
Protein ID: 259907316
SecReT6 ID331
T6SS typei3
Gene symbolvgrG1
Locus tagEpC_06400
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]742223..744184 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDD0FP76
KEGG IDepy:EpC_06400
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.70E-71, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.90E-25, Aligned region: 365..458
Protein Sequence: 653 a.a.     [Download]
>gi|259907316|ref|YP_002647672.1| Rhs element Vgr protein [Erwinia pyrifoliae Ep1/96]
MFDRITVQLPMDGLLFWRMSGREALSQSFELSVQLLSTDARIERRALLGQPIVISIPTQGIMSTRYLNGK
ITKVSVSSQELSGTRYAVYTLVMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLGEYNVALEDRLTGSYRSW
EYCVQYQESSFNFISRLMELEGIYYYFRHEADGHRLVLMDAEQQHQPFSGYEAIPYHATPSGGITSAEGI
SGWEFADAVTPGIYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHDHGEFYVKIRQQVWQ
VEHQQISATGTALGLAPGYTFAVLNAPFISDNGEYLTTEACYDFEENSYASGGDSSSRHNISVQVIPSDI
TFRAQPDTPWPRTHGPQTAKVVGPKGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGG
VQIPRVGDEVVVDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFEDKAG
HEQIWLHAEKNMDTEVEHCETHDVGVDRHKTVGRDEKNIVKRNMLTDVGMHATSHTAEKHIINVGEDQAV
LTMDKQGNVLLEATASIRLKVKNNYILITPSAIEIQVAEGDLMAESEKGALLKGNELTLLGGGTDAELSA
SDTVSITGTNATDIKGALVKVNS
 
Nucleotide Sequence: 1962 bp     [Download]
>gi|259906682|ref|NC_012214.1|:742223-744184 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGTTTGACCGTATCACCGTACAGCTGCCGATGGACGGCCTGCTGTTCTGGCGCATGAGCGGGCGCGAAG
CGCTGTCGCAGTCATTTGAACTGAGCGTGCAGCTGTTAAGCACCGATGCGCGCATCGAGCGCAGGGCGCT
GCTCGGCCAGCCGATCGTCATCTCCATCCCCACCCAGGGGATAATGAGTACCCGCTACCTGAACGGCAAA
ATCACCAAAGTGTCGGTCAGCAGCCAGGAGCTGAGCGGCACGCGCTACGCGGTGTATACCCTGGTGATGG
AGCCGGACCTGTGGCCGCTGAAGCGCGACAAAAATCTGCGCATTTTCCAGGGGCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTGGGTGAGTACAACGTGGCGCTGGAAGACCGGCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTTAACTTTATCAGCCGCCTGATGGAGCTGGAGGGGATCT
ACTACTACTTCCGCCACGAGGCGGACGGGCACAGGCTGGTGCTGATGGACGCGGAGCAGCAGCACCAGCC
GTTCAGCGGCTACGAGGCGATCCCTTACCACGCCACGCCATCCGGTGGCATTACCAGCGCAGAAGGTATC
AGCGGCTGGGAGTTTGCCGATGCGGTCACACCGGGTATCTACAGCATCGACGACTACGACTTCCGCAAAC
CGAACGCATGGATGCTGCAGGCGCGGCAGAATCCGGCCTCGCCGCAGCCGGGGGCGATAGACGTCTACGA
CTGGCCTGGCCACTTTGTTGACCACGATCACGGTGAGTTCTACGTGAAAATCCGCCAGCAAGTGTGGCAG
GTGGAGCATCAGCAGATTAGCGCCACAGGCACCGCACTCGGCCTGGCACCGGGTTACACCTTTGCGGTGT
TGAATGCGCCCTTTATCAGTGATAACGGTGAATATCTGACCACCGAAGCCTGCTATGACTTTGAGGAAAA
CAGCTACGCCAGCGGCGGCGATAGCAGCAGCAGGCACAATATCTCTGTTCAGGTGATCCCTTCGGATATC
ACCTTCCGCGCACAGCCGGACACGCCGTGGCCGCGCACCCACGGGCCGCAGACGGCGAAGGTGGTGGGGC
CGAAGGGCGAGTCGATCTGGACCGATAAATATGGCCGCATCAAAGTGAAATTTCACTGGGACAGGCTGGC
GAAGGGCGACGATACCAGCTCGTGCTGGGTGCGCGTCTCCAGCGCCTGGGCGGGCCAGGGCTACGGTGGG
GTGCAGATCCCGCGCGTGGGCGACGAGGTGGTGGTCGACTTTATCAACGGCGACCCGGACCGACCGATCG
TCACCGGGCGCGTGTACAACGAGGCGAGCATGCCGCCGTGGGCGCTGCCCGCCGCCGCCACGCAGATGGG
CTTTATGAGCCGTTCGAAGGACGGTACGCCGGACAACGCCAACGCGCTGCGCTTTGAGGATAAAGCGGGT
CATGAACAAATCTGGCTGCATGCGGAAAAAAATATGGATACCGAGGTTGAACATTGCGAAACCCATGATG
TCGGCGTCGATCGTCATAAAACCGTTGGCCGCGACGAGAAAAACATCGTTAAACGCAACATGCTGACTGA
CGTTGGTATGCATGCAACCAGCCATACCGCAGAGAAACATATCATCAACGTCGGTGAGGATCAGGCCGTT
CTGACCATGGATAAGCAGGGTAATGTGCTGCTTGAAGCCACTGCCAGCATCAGGCTGAAGGTGAAAAATA
ATTACATTCTGATCACCCCATCAGCGATCGAAATACAGGTGGCGGAAGGGGATCTGATGGCGGAAAGCGA
GAAAGGGGCCTTATTGAAAGGCAACGAGCTTACCCTGCTGGGCGGAGGAACCGATGCGGAACTGAGCGCC
AGTGACACCGTCAGTATTACCGGAACCAACGCCACCGATATCAAAGGCGCGCTGGTCAAAGTAAACAGCT
AA