SecReT6
Protein ID: 259907320
SecReT6 ID331
T6SS typei3
Gene symbolvgrG2
Locus tagEpC_06440
StrainErwinia pyrifoliae Ep1/96
Repliconchromosome [GenBank: NC_012214] [Browse all T6SS(s) in this replicon]
Location [Strand]747098..749026 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDD0FP80
KEGG IDepy:EpC_06440
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-73, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.60E-25, Aligned region: 366..459
Gp5_C [PF06715], Evalue: 0.0094, Aligned region: 502..521
Protein Sequence: 642 a.a.     [Download]
>gi|259907320|ref|YP_002647676.1| Rhs element Vgr protein [Erwinia pyrifoliae Ep1/96]
MFDRITVQLPMDGLLFWRMSGREALSQSFELSVQLLSTDARIERRALLGQPITVCIPTQGIMSTRYLNGK
ITKVSVRSQELSGTRYAVYTLVMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLGEYNVALEDRLTGSYRSW
EYCVQYQESSFNFISRLMELEGIYYYFRHEADGHRLVLMDAAQQHQPFSGYEAIPYHVTPSGGSTSEEGI
GLWSLEDSVTPGMYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHDHGEFYARIRQEVWQ
AEHQQISAAGTALGLAPGNTFTVLNTPFISDNGEYLTTEAYYDFEENQYASGDGGGGTKHNIAIRVIPSG
VTFRATPGTPWPRTHGPQTAKVVGPKGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFEDKA
GEEQVWIQAERNMDTQVKNDASHSVGKNHSHYVGESELHRVETDRVHGIKGGEQLLTGKGKSDAAAEAYV
IGSGTTLRLECGESVIELTASGQINIVGKGFNFCVEQDGFINTGGKLNINDGTGAATAAPGSSHKANITR
AVEALFPTKKGE
 
Nucleotide Sequence: 1929 bp     [Download]
>gi|259906682|ref|NC_012214.1|:747098-749026 Erwinia pyrifoliae Ep1/96 chromosome, complete genome
ATGTTTGACCGTATCACCGTACAGCTGCCGATGGACGGCCTGCTGTTCTGGCGCATGAGCGGGCGCGAAG
CGCTGTCGCAGTCATTTGAACTGAGCGTGCAGCTGTTAAGCACCGACGCGCGCATTGAGCGCAGGGCGCT
GCTCGGCCAGCCGATCACCGTTTGCATCCCCACCCAGGGCATAATGAGCACGCGCTATCTGAACGGCAAA
ATCACCAAAGTTTCGGTCCGCAGCCAGGAGCTGAGCGGCACGCGCTACGCGGTGTACACCCTGGTGATGG
AGCCGGACCTGTGGCCGCTGAAGCGCGACAAAAATCTGCGCATTTTCCAGGGGCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTGGGTGAGTACAACGTGGCGCTGGAAGACCGGCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTTAACTTTATCAGCCGGCTGATGGAGCTGGAGGGGATCT
ACTACTACTTCCGCCACGAGGCGGACGGGCACAGGCTGGTGCTGATGGACGCGGCGCAGCAGCATCAGCC
GTTCAGCGGCTACGAGGCGATCCCTTACCACGTCACGCCGTCCGGCGGCAGCACCAGTGAAGAGGGCATC
GGGCTGTGGTCACTGGAGGACAGCGTGACGCCGGGGATGTACAGCATCGACGACTACGACTTCCGCAAAC
CGAACGCATGGATGCTGCAGGCGCGGCAGAATCCGGCGTCGCCGCAGCCGGGTGCCATCGACGTTTACGA
CTGGCCGGGGCATTTTGTTGACCACGACCACGGCGAATTCTATGCGCGCATTCGTCAGGAGGTGTGGCAG
GCGGAGCACCAGCAGATTAGCGCCGCCGGCACCGCGCTGGGGCTGGCGCCGGGCAACACCTTTACGGTGC
TGAACACGCCGTTTATCAGCGATAACGGCGAGTACCTGACCACGGAGGCGTACTACGATTTTGAAGAGAA
CCAGTATGCCAGCGGTGACGGTGGTGGCGGAACAAAACACAATATCGCCATCCGCGTAATCCCCTCCGGC
GTGACTTTCCGCGCCACGCCGGGAACGCCGTGGCCGCGCACCCACGGGCCGCAGACGGCGAAGGTGGTGG
GGCCGAAGGGCGAGTCGATCTGGACCGATAAATATGGCCGCATCAAAGTGAAATTTCACTGGGACAGGCT
GGCAAAAGGCGACGATACTAGCTCGTGCTGGGTGCGCGTCTCCAGCGCCTGGGCGGGCCAGGGCTATGGC
GGGGTGCAGATCCCGCGCGTGGGCGACGAGGTGGTTGTCGACTTTATCAACGGCGATCCGGATCGGCCAA
TCGTCACCGGTCGCGTGTACAACGAGGCGAGCATGCCGCCGTGGGCGCTGCCCGCCGCCGCCACGCAGAT
GGGCTTTATGAGCCGCTCAAAAGACGGCACGCCGGACAACGCCAACGCGCTGCGCTTTGAGGATAAGGCG
GGCGAGGAGCAGGTGTGGATCCAGGCCGAGCGCAATATGGATACCCAGGTGAAGAATGATGCCAGCCACA
GCGTGGGTAAAAATCACAGTCATTACGTTGGAGAAAGTGAGCTGCACCGGGTAGAGACCGATCGCGTGCA
CGGCATTAAGGGCGGCGAACAGCTGCTGACCGGCAAAGGGAAAAGCGATGCGGCGGCAGAAGCCTATGTA
ATAGGTTCCGGCACCACGCTGCGCCTGGAGTGTGGTGAAAGCGTCATTGAACTGACCGCCAGCGGGCAGA
TCAATATTGTCGGCAAGGGCTTTAATTTCTGTGTAGAACAGGACGGCTTTATCAATACCGGCGGTAAGCT
GAATATTAATGATGGTACGGGGGCAGCCACCGCCGCACCGGGTTCATCCCATAAAGCCAATATTACCCGT
GCCGTGGAAGCGCTGTTCCCGACAAAAAAAGGGGAGTAA