SecReT6
Protein ID: 260595857
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00650
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]62476..62919 [+]
Producthypothetical protein
NoteTssJ
UniProt IDC9Y412
KEGG IDctu:CTU_00650
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-31, Aligned region: 1..138
Protein Sequence: 147 a.a.     [Download]
>gi|260595857|ref|YP_003208428.1| unnamed protein product [Cronobacter turicensis z3032]
MSGCLSSSRSVPSQYSLHFQAHPQINNSAPLKVRVLLLKSDADFMSADFFSLQNNAQTVLGANLLNSDEF
FLMPGQLDKTLSGQSSLDARYIGVMAEYQALDGKKWRISLPLPAPTDSSIYKFWKWSSDELEAKVFLDVN
GIRVINE
 
Nucleotide Sequence: 444 bp     [Download]
>gi|325295716|ref|NC_013282.2|:62476-62919 Cronobacter turicensis z3032 chromosome, complete genome
CTGAGCGGCTGCTTATCGTCTTCACGCAGCGTTCCTTCCCAGTACAGCCTGCATTTTCAGGCTCACCCGC
AAATTAATAATTCCGCCCCGCTGAAAGTCCGGGTGCTGCTTTTGAAATCCGATGCCGACTTTATGTCTGC
CGATTTCTTTTCGCTGCAAAACAATGCTCAGACCGTGCTGGGAGCGAACCTGCTCAACAGCGACGAGTTC
TTCCTGATGCCAGGCCAGCTGGATAAAACCCTCAGCGGCCAGAGCTCGCTTGACGCGCGCTACATCGGCG
TGATGGCGGAATATCAGGCGCTGGACGGCAAGAAGTGGCGAATCTCGCTCCCGCTCCCCGCACCCACGGA
CTCCAGTATTTACAAATTCTGGAAATGGTCATCCGACGAACTTGAGGCGAAAGTGTTTCTTGACGTCAAC
GGGATCCGCGTCATCAACGAATAA