SecReT6
Protein ID: 260595858
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00660
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]62944..64287 [+]
Producthypothetical protein
NoteTssK
UniProt IDC9Y413
KEGG IDctu:CTU_00660
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-143, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|260595858|ref|YP_003208429.1| unnamed protein product [Cronobacter turicensis z3032]
MNKAEKVVWTEGMFLRPHHFQRAESFLQHHIREWGSLQRPYLWGFLDLEFDEAMLRQGRVALSYASGLLP
DGTPFSFRDARHGPAPLAIPDNLTHERVVLALPARRAGREEVIFSEAADSLARYATFEEEVEDDNALAVG
AATVQFGRLRLKLMLESELTAEWTAIGVAQVIEKRNDNQVRLDTSYIPPMLNAINSGPLYSMLNDLHGLL
GQRSQQISQRLRQPGRFNTSEMVEFMLLSLINHHLGHVTHLKTLPLLHPETLWRDWLAFACELTTWTAQR
APDATLPVYDHDNLAGCFGKLTLMLRQGLSLVMEESAIQLPLTERSHGLNVATVPESNMVREFGFVLAVK
ANVPGEALQTHFPAQMKVAPVTKIRDLVQLQLPGMVLRAMPVAPPQIPWHAGYSYFELEKGGELWKEMEK
SGAFALHLAGEFPGLDMEFWAIRSTNE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|325295716|ref|NC_013282.2|:62944-64287 Cronobacter turicensis z3032 chromosome, complete genome
ATGAACAAAGCAGAAAAAGTGGTCTGGACCGAAGGGATGTTCCTGCGTCCGCACCACTTCCAGCGTGCGG
AAAGTTTCCTGCAACATCACATCCGCGAATGGGGTTCGTTGCAGCGTCCGTATCTCTGGGGATTTCTCGA
TCTGGAATTTGACGAGGCGATGCTGCGTCAGGGACGCGTGGCGCTGAGCTACGCCAGCGGTCTGCTGCCG
GACGGCACGCCGTTCTCTTTCCGCGACGCCCGCCACGGCCCGGCGCCGCTCGCCATCCCCGATAACCTCA
CGCACGAGCGCGTGGTGCTGGCGTTGCCCGCCCGCCGCGCCGGACGCGAAGAAGTGATTTTCAGCGAGGC
GGCCGATTCGCTCGCCCGCTACGCCACCTTTGAAGAAGAGGTGGAAGACGACAACGCGCTGGCGGTCGGC
GCGGCGACGGTGCAGTTTGGCCGCCTGCGTCTCAAGCTGATGCTGGAGAGCGAACTGACCGCCGAGTGGA
CCGCCATTGGCGTCGCGCAGGTCATTGAAAAGCGCAACGACAACCAGGTGCGTCTCGACACCAGCTACAT
TCCGCCGATGCTTAACGCCATCAACAGCGGGCCGCTCTACAGCATGCTCAACGATCTGCATGGCCTGCTC
GGCCAGCGCAGCCAGCAAATCAGCCAGCGCTTGCGCCAGCCGGGCCGGTTTAACACCTCCGAGATGGTGG
AGTTCATGCTGCTGTCGCTGATTAACCATCATCTGGGCCACGTCACGCATTTAAAAACGCTGCCGTTGCT
GCACCCGGAAACCCTCTGGCGCGACTGGCTGGCGTTCGCCTGCGAGCTCACCACCTGGACGGCGCAGCGC
GCGCCGGATGCGACGCTGCCGGTTTACGACCATGACAACCTGGCGGGCTGCTTTGGCAAACTGACGCTGA
TGCTGCGCCAGGGCCTGTCGCTGGTGATGGAAGAGAGCGCCATTCAGCTGCCGCTCACCGAGCGTTCACA
CGGGCTCAACGTCGCCACCGTGCCGGAAAGCAACATGGTGCGCGAGTTCGGTTTCGTGCTGGCGGTCAAA
GCCAACGTGCCGGGCGAGGCGCTGCAAACGCACTTCCCGGCGCAGATGAAAGTCGCGCCGGTCACCAAAA
TTCGCGATCTGGTGCAGCTGCAACTGCCGGGTATGGTGCTGCGCGCCATGCCGGTTGCGCCGCCGCAGAT
CCCGTGGCATGCCGGCTACAGCTATTTCGAACTGGAAAAGGGCGGCGAACTCTGGAAAGAGATGGAAAAA
TCCGGCGCGTTCGCGCTGCATCTCGCCGGTGAATTCCCGGGCCTTGATATGGAGTTTTGGGCCATTCGCA
GTACGAATGAATAA