SecReT6
Protein ID: 260595859
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00670
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]64398..65540 [+]
Producthypothetical protein
NoteTssL
UniProt IDC9Y414
KEGG IDctu:CTU_00670
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-64, Aligned region: 3..193
DUF2077 [PF09850], Evalue: 3.10E-64, Aligned region: 332..357
OmpA [PF00691], Evalue: 3.40E-15, Aligned region: 258..356
Protein Sequence: 380 a.a.     [Download]
>gi|260595859|ref|YP_003208430.1| unnamed protein product [Cronobacter turicensis z3032]
MPQIRHSVSHEDQAGLRQRLIDEIRRFEVRCQQAALPYEVIVGARYCLCTALDEAAALTPWGSRGVWSGS
GLLVTFHNETWGGEKFFQLLARLSQNPREHIFLLEMINYCLLLGFEGRYRVMDNGRTQLETIKQRLWQMI
RSVRGSYPPPLSPHPEDQPVLRKLWRPVVPLWACVALAGFLACLFFIILNWRLGDNTSPVLAKIYQTPLP
EVTVQQPAREVAPVLNLRGFLRPEIEAGLVAVRDEADRSVVILKGDGLFASASTVVRDRYEPVIDRVAQA
MNNVSGKILVVGYSDNVPIRSARFASNYELSLSRAESVQKMLQAHLADPSRVRAQGRGEMDPIAPNNTPE
NRARNRRVEITLLVSPDNTLAELNGLPQGN
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|325295716|ref|NC_013282.2|:64398-65540 Cronobacter turicensis z3032 chromosome, complete genome
ATCCCGCAGATTCGTCATTCTGTTTCGCATGAAGATCAGGCCGGGCTGCGCCAGCGTCTGATCGATGAGA
TCCGCCGCTTTGAAGTGCGCTGCCAGCAGGCGGCGCTGCCTTACGAAGTGATCGTCGGCGCGCGCTACTG
CCTGTGTACGGCGCTCGATGAAGCGGCAGCGCTCACGCCGTGGGGTAGCCGTGGCGTCTGGTCCGGCAGT
GGTCTGCTGGTGACGTTCCACAACGAAACCTGGGGCGGCGAGAAATTCTTCCAGCTCCTGGCGCGGCTGT
CGCAAAACCCGCGCGAGCACATCTTTCTGCTGGAGATGATCAACTACTGCCTGCTGCTCGGCTTCGAAGG
GCGCTATCGCGTCATGGACAACGGCCGCACGCAGCTTGAAACCATCAAACAGCGCCTGTGGCAGATGATT
CGCAGCGTGCGCGGCAGCTACCCGCCGCCGCTCTCGCCGCATCCGGAAGATCAACCGGTGCTGCGCAAGC
TCTGGCGTCCTGTGGTGCCGCTGTGGGCCTGCGTGGCGCTGGCCGGTTTCCTGGCATGTCTGTTCTTTAT
CATTCTTAACTGGCGGCTTGGCGATAACACCAGCCCGGTGCTGGCGAAGATTTACCAGACGCCGCTGCCG
GAAGTCACCGTTCAACAGCCCGCGCGAGAAGTGGCGCCAGTGCTTAACCTGCGCGGTTTCCTGCGTCCGG
AAATTGAAGCGGGCCTGGTGGCGGTGCGCGACGAAGCCGATCGCAGCGTGGTGATTCTGAAAGGCGACGG
TCTGTTCGCGTCCGCCTCGACCGTGGTGCGTGACCGTTATGAACCGGTTATCGACCGCGTGGCGCAGGCG
ATGAACAACGTCAGCGGCAAAATCCTCGTGGTGGGCTACAGCGACAACGTGCCTATCCGCAGCGCGCGTT
TCGCTTCTAACTACGAGCTGTCGCTCTCGCGCGCCGAATCGGTACAGAAAATGCTCCAGGCGCACCTCGC
CGACCCGAGCCGCGTCAGAGCGCAGGGCCGTGGCGAGATGGACCCTATCGCTCCGAACAATACGCCGGAA
AACCGCGCCCGCAACCGCCGTGTAGAGATAACTCTGCTGGTGTCGCCGGATAACACTCTGGCCGAGCTGA
ACGGATTGCCGCAAGGAAACTAA