SecReT6
Protein ID: 260595862
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00700
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]69897..70919 [+]
Producthypothetical protein
NoteTssA
UniProt IDC9Y417
KEGG IDctu:CTU_00700
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.00E-20, Aligned region: 52..111
Protein Sequence: 340 a.a.     [Download]
>gi|260595862|ref|YP_003208433.1| unnamed protein product [Cronobacter turicensis z3032]
MDIETLLTPVSPEQPCGENLEYDADYQAMEQASQGKAEQQFGDTIIPAEPADWTKVEKLALSLLERTKDL
RVMLALTHAWAKRRGLPGYADGLLLIQEALTRYWEPLYPLLEEYGEKDPFYRINALAGLGDKSALTGTLR
TATLLRSNGDEITLRDAQSLLDNSKSECPGYPGGRPRLVDELARGDQPGIEAIVQIHTRLETIRTILVNH
LGESGVPEMEQLQKLTSIVALACQSGEPQAPQDVQDPQAQTDDAPAATTTRAPARVVETDWRNVQLQTRD
DAQLMLEKVKQYFARHEPSHPAPLMIERVQRLIEMNFMDLIRDLAPDSVHQVENIIGRRE
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|325295716|ref|NC_013282.2|:69897-70919 Cronobacter turicensis z3032 chromosome, complete genome
ATGGATATTGAAACCCTTCTTACTCCGGTGAGCCCGGAGCAGCCGTGCGGCGAAAACCTGGAGTACGACG
CCGATTACCAGGCGATGGAACAGGCAAGCCAGGGCAAGGCGGAACAGCAGTTCGGCGACACCATTATTCC
GGCAGAGCCGGCGGACTGGACTAAAGTTGAAAAGCTGGCCCTGTCGCTGCTTGAGCGTACCAAAGATCTG
CGCGTCATGCTGGCGCTGACTCACGCATGGGCCAAACGCCGCGGCCTGCCGGGCTATGCCGACGGGCTGC
TGCTGATCCAGGAAGCGCTGACGCGCTACTGGGAGCCGCTCTATCCGTTGCTGGAAGAGTACGGCGAAAA
AGATCCGTTCTACCGTATTAACGCGCTGGCGGGCCTTGGCGATAAATCCGCCCTGACCGGCACGCTGCGC
ACCGCCACGCTGCTGCGCAGCAACGGCGATGAAATTACGCTGCGCGACGCGCAGTCGTTGCTCGACAACA
GCAAAAGCGAATGTCCGGGTTATCCGGGCGGTCGCCCGCGACTGGTGGATGAACTCGCGCGCGGCGATCA
GCCGGGCATCGAGGCGATAGTCCAGATCCACACGCGGCTGGAAACGATCCGCACCATTCTGGTTAACCAC
CTCGGTGAGAGCGGCGTGCCGGAGATGGAGCAGCTCCAGAAGCTGACCAGCATTGTGGCGCTGGCCTGCC
AGAGCGGCGAACCCCAGGCGCCGCAGGATGTGCAAGACCCGCAGGCGCAGACCGATGACGCGCCTGCCGC
CACGACGACCCGCGCCCCGGCGCGCGTGGTGGAAACCGACTGGCGCAACGTGCAGTTACAAACGCGCGAC
GACGCCCAGTTAATGCTTGAGAAAGTGAAGCAATATTTTGCCCGGCATGAGCCGAGCCACCCCGCGCCGC
TGATGATTGAGCGCGTGCAGCGACTGATTGAAATGAATTTCATGGATCTTATTCGCGACCTGGCGCCTGA
CAGCGTGCATCAGGTGGAAAACATTATCGGACGCCGGGAATAA