SecReT6
Protein ID: 260595863
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00710
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]70965..71519 [+]
Producthypothetical protein
NoteTssB
UniProt IDC9Y418
KEGG IDctu:CTU_00710
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.20E-60, Aligned region: 21..174
Protein Sequence: 184 a.a.     [Download]
>gi|260595863|ref|YP_003208434.1| hypothetical protein CTU_00710 [Cronobacter turicensis z3032] [TssB]
MHRASSMENIMPMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVFADLVGKPVDPQPAVDER
KFLEIDIDNFDERMKALKPRVAFQVDNTLTGEGKLNIDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLS
NLLTYMDGKNGAEELIAKVLQDPTLLKSLSQMPKNDDGTKGNEE
 
Nucleotide Sequence: 555 bp     [Download]
>gi|325295716|ref|NC_013282.2|:70965-71519 Cronobacter turicensis z3032 complete genome [TssB]
ATTCACCGCGCATCTTCGATGGAGAACATCATGCCAATGAGTAACAGTGGGCAGAAATTTATCGCCCGTA
ACCGCGCGCCGCGCGTGCAGATCGAGTACGACGTGGAAATCTACGGCGCGGAACGCAAAATTCAGCTTCC
GTTTGTGATGGGCGTGTTTGCCGACCTGGTCGGGAAGCCGGTCGATCCGCAGCCTGCGGTGGACGAACGT
AAATTCCTTGAGATTGATATCGATAACTTCGACGAGCGTATGAAAGCGCTCAAGCCGCGCGTGGCGTTCC
AGGTGGACAACACCCTGACCGGCGAAGGCAAACTGAATATCGATCTGACGTTCGACAGCATGGACGACTT
CCTGCCGGACGCCGTCGCGCGTAAGGTCGAGCCGCTGAACAAGCTGCTGGAAGCCCGTACTCAACTTTCT
AACCTGCTGACCTACATGGACGGTAAAAACGGCGCCGAAGAGCTTATCGCGAAAGTGCTTCAGGATCCGA
CGCTGCTCAAATCACTGAGCCAGATGCCGAAAAATGACGATGGCACGAAAGGTAACGAGGAGTAA